BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30245 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58413| Best HMM Match : GIY-YIG (HMM E-Value=0.31) 29 2.4 SB_26505| Best HMM Match : DUF1299 (HMM E-Value=0.78) 29 3.2 SB_32848| Best HMM Match : S-antigen (HMM E-Value=8.5e-05) 28 7.4 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 27 9.7 SB_25282| Best HMM Match : rve (HMM E-Value=6.3e-12) 27 9.7 >SB_58413| Best HMM Match : GIY-YIG (HMM E-Value=0.31) Length = 366 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +2 Query: 119 ICSTRADTRIMSTRSARSGSPHRYECETYECAADGDGKLQRLAAVRAATGTASPAGNTSR 298 +C+ R T I S R + HRY T+ D Q L A+R T P+ + R Sbjct: 124 LCNKRPSTGIPSPRLVHYETKHRYTKPTFCAIRDQAQVYQALCALRDQTQKLQPSTSPKR 183 >SB_26505| Best HMM Match : DUF1299 (HMM E-Value=0.78) Length = 535 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 280 GWKYVPAE--ADSGQCCGKCEPVACVVDGEEKPIGEKWTSSDFCTNFTCVNLNGT 438 GW P E +++ + C +CE + DG E I + W+SS+ T+ T +++ T Sbjct: 55 GWTICPGEIRSENSRDC-RCETP--LTDGGESVISDSWSSSE-VTDTTSISMEST 105 >SB_32848| Best HMM Match : S-antigen (HMM E-Value=8.5e-05) Length = 555 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/70 (24%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = +1 Query: 346 CVVDGEEKPIGEKWTSSDFCTNFTCVNLNGTLQVQSSNETCPEISDAERKQF--VLKSRR 519 CV G + + D+ TNF C L G V N+ ++ + KQ + K Sbjct: 97 CVSYGSISIVRATMCNGDYITNFACRCLIGDFSVARRNKENAKLRETNEKQMRALKKMEE 156 Query: 520 SQGSAAPRSN 549 G+ + + N Sbjct: 157 KAGNTSKKFN 166 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 412 FTCVNLNGTLQVQS--SNETCPEISDAERKQFVLKSRRSQGSA--APRSNVRR 558 ++CV LNGT Q+ + CP+ E+K + K+ + +G APR++ R Sbjct: 248 YSCVKLNGTSMAQNYPPDTVCPQARIQEKKD-LEKTEQEEGCEVYAPRASCIR 299 >SB_25282| Best HMM Match : rve (HMM E-Value=6.3e-12) Length = 451 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 187 SMGTSTSRRPCRHYPGVCXRAAYL 116 S G TS RP RHYP C R +L Sbjct: 174 SEGAPTSERPPRHYP-ACWRLIHL 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,035,177 Number of Sequences: 59808 Number of extensions: 396415 Number of successful extensions: 1338 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1338 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -