BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30245 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13590.1 68418.m01572 expressed protein 33 0.21 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 28 4.5 At3g14460.1 68416.m01832 disease resistance protein (NBS-LRR cla... 28 4.5 At3g12800.1 68416.m01597 short-chain dehydrogenase/reductase (SD... 28 6.0 At2g19880.1 68415.m02324 ceramide glucosyltransferase, putative ... 27 7.9 At1g21450.1 68414.m02682 scarecrow-like transcription factor 1 (... 27 7.9 >At5g13590.1 68418.m01572 expressed protein Length = 1190 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 422 TQVKFVQKSEDVHFSPI-GFSSPSTTQATGSHLPQHWPL 309 T+VKF + S +H SP+ GF PS++ GS + H+P+ Sbjct: 60 TRVKFEKPSSPIHSSPLAGFDIPSSSNVLGSSI--HFPM 96 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 28.3 bits (60), Expect = 4.5 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +2 Query: 86 PRPVPFASCPEICSTRADTRIMSTRSARSGSPHRYECETYECAADG-DGKLQRLAAVRAA 262 P+P+ S T ++R +S+ + S SPHR + +A G + AA + Sbjct: 484 PKPLGRFSATHSSDTVKESRTLSSTGSVSDSPHRVTLTSAPKSASGISTVVPNAAASKRN 543 Query: 263 TGTASPAGN 289 G A+P N Sbjct: 544 FGKANPKAN 552 >At3g14460.1 68416.m01832 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 1424 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 366 EANRREVDVLGLLHELHLREPQWHPPSPKLE*DLP 470 E + + ++V+GL REPQW S DLP Sbjct: 130 EHHVKHIEVIGLKEYSETREPQWRQASRSRPDDLP 164 >At3g12800.1 68416.m01597 short-chain dehydrogenase/reductase (SDR) family protein contains Pfam profile PF00106:oxidoreductase, short chain dehydrogenase/reductase family Length = 298 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 91 PRALRILPGDMQHAXRHQDNVYKVGEKW 174 P +++P ++++ R +YKVGEKW Sbjct: 207 PGMSKLVPEEIENKTREYMPLYKVGEKW 234 >At2g19880.1 68415.m02324 ceramide glucosyltransferase, putative similar to ceramide glucosyltransferase (GI:14718995) [Gossypium arboreum]; weak similarity to Ceramide glucosyltransferase (Glucosylceramide synthase) (GCS) (UDP-glucose:N-acylsphingosine D-glucosyltransferase) (GLCT-1) (Swiss-Prot:Q16739) [Homo sapiens] Length = 519 Score = 27.5 bits (58), Expect = 7.9 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -1 Query: 255 RTAASRCSLPSPSAAHSYVSHSYRWGLPLLADLVDIIL--VSARVLHISGQDAKGTGRGY 82 R C++ SP A ++ +Y WGL +A LVD L +SA H S Q +G Y Sbjct: 403 RREVQLCNMLSPEAPRLSLA-TYNWGLVFVAMLVDNFLYPISAFRSHFS-QSINWSGIRY 460 Query: 81 SI 76 + Sbjct: 461 HL 462 >At1g21450.1 68414.m02682 scarecrow-like transcription factor 1 (SCL1) identical to scarecrow-like 1 GB:AAF21043 GI:6644390 from [Arabidopsis thaliana] Length = 593 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -3 Query: 535 QHFPGTFCSSARTASVQHPISPGKSHSSFG 446 Q + F S VQHPI G S SSFG Sbjct: 68 QSYEKYFLDSPTDEFVQHPIGSGASVSSFG 97 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,867,759 Number of Sequences: 28952 Number of extensions: 259700 Number of successful extensions: 899 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -