BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30243X (549 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10642| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_236| Best HMM Match : QPP (HMM E-Value=1.8) 28 4.4 SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 28 5.8 SB_34529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_15895| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 28 5.8 >SB_10642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 85.8 bits (203), Expect = 2e-17 Identities = 44/84 (52%), Positives = 57/84 (67%) Frame = -3 Query: 505 RLMPVNSLEERILAAPGSKLTLAEKVTQAGMSNQKSTGSDRQQFLQSILHQAGXXXXXXX 326 RLM VNS+EE+ILAA KL + EKV QAGM NQ ST S+R+ FL ++L Sbjct: 636 RLMTVNSVEEKILAAARYKLNVDEKVIQAGMFNQNSTSSERKAFLMALLDTENDDDEEES 695 Query: 325 XVPDDDLINAMIARSEEELEIFKQ 254 VPDD+ +N MIARSEEE E++++ Sbjct: 696 EVPDDETVNQMIARSEEEFELYQR 719 Score = 73.7 bits (173), Expect = 9e-14 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 8/84 (9%) Frame = -2 Query: 260 QTIDLERKKTE--------KHSRLIEESELPDWLVKDDDEVVCNKGQGWNYLDEDETLGR 105 Q +D+ER++TE + RL+ ++ELP W++KDD+EV + W +E++ R Sbjct: 718 QRMDIERRRTEVRDPTTHRRRPRLMADNELPRWILKDDNEV---ERLTWEE-EEEKMFAR 773 Query: 104 GSRQRKEVDYTDSLTEKEWLKAID 33 GSRQRK+VDY++ LTEK+WLKAI+ Sbjct: 774 GSRQRKKVDYSEHLTEKQWLKAIE 797 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 128 DEDETLGRGSRQRKEVDYTDSLTEKE 51 DE LG+G R RK+V+Y D+ E + Sbjct: 1292 DEARELGKGKRIRKQVNYVDTGIEDQ 1317 >SB_236| Best HMM Match : QPP (HMM E-Value=1.8) Length = 217 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = -2 Query: 188 WLVKDDDEVVCNKGQGWNYLDEDETLGRGSRQRKEVDYTDSLTEKEWLK 42 W+ +++D N+GQ +++ R RQR + +T+ + E K Sbjct: 92 WIEQEEDREQTNRGQNKKKTQNRQSVDRTRRQRTDKSWTEQEEDTEQTK 140 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = -2 Query: 188 WLVKDDDEVVCNKGQGWNYLDEDETLGRGSRQRKEVDYTDSLTEKEWLK 42 W+ +++D N+GQ +++ R RQR + +T+ + E K Sbjct: 167 WIEQEEDREQTNRGQNKKKTHNRQSVDRTRRQRTDKSWTEQEEDTEQTK 215 >SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) Length = 825 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 7/58 (12%) Frame = -2 Query: 248 LERKKTEKHSRLIEESELPDWLVKD-DDEVVCNK------GQGWNYLDEDETLGRGSR 96 LERKK KH R+ E P +V D E+ K G ++ ++D+T+ G R Sbjct: 558 LERKKFNKHLRIYAEKNKPKTIVADVAKEMPFKKFKSLWSKDGLHFTEKDQTIETGKR 615 >SB_34529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/64 (31%), Positives = 29/64 (45%) Frame = -2 Query: 242 RKKTEKHSRLIEESELPDWLVKDDDEVVCNKGQGWNYLDEDETLGRGSRQRKEVDYTDSL 63 R+K+ KHS +EE+ D E + D D GR S +R+ TDS Sbjct: 71 RRKSHKHSLSVEETGRRRMRHDTDSESERESRRPRARHDTDSESGRESGRRRARHDTDSE 130 Query: 62 TEKE 51 +E+E Sbjct: 131 SERE 134 >SB_15895| Best HMM Match : Hint (HMM E-Value=1.4013e-45) Length = 561 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 7/58 (12%) Frame = -2 Query: 248 LERKKTEKHSRLIEESELPDWLVKD-DDEVVCNK------GQGWNYLDEDETLGRGSR 96 LERKK KH R+ E P +V D E+ K G ++ ++D+T+ G R Sbjct: 294 LERKKFNKHLRIYAEKNKPKTIVADVAKEMPFKKFKSLWSKDGLHFTEKDQTIETGKR 351 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,854,554 Number of Sequences: 59808 Number of extensions: 284791 Number of successful extensions: 766 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -