BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30243X (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 2.2 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 8.8 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 360 RILCRNCCRSDPVDFWLDIPAWVTFSA 440 +I C CC F+ +P W T+SA Sbjct: 146 KIYC--CCHFSMATFFWFMPVWTTYSA 170 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +3 Query: 387 SDPVDFWLDIPAWVTFSAKVNLEPGAAKILSSKELTGMS 503 S+P F L + ++ + P ++ S E+TG S Sbjct: 683 SEPAGFSLSATLFTNHPHRLEIIPNLLRVFVSIEMTGQS 721 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,487 Number of Sequences: 2352 Number of extensions: 8871 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -