BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30241 (695 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0Q551 Cluster: Putative uncharacterized protein; n=8; ... 37 0.54 UniRef50_Q9PYP9 Cluster: ORF147; n=1; Xestia c-nigrum granulovir... 36 1.3 UniRef50_A4VDG4 Cluster: Putative uncharacterized protein; n=1; ... 33 8.8 >UniRef50_A0Q551 Cluster: Putative uncharacterized protein; n=8; Francisella tularensis|Rep: Putative uncharacterized protein - Francisella tularensis subsp. novicida (strain U112) Length = 87 Score = 36.7 bits (81), Expect = 0.54 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 500 YKNKVGC-CHVVERSPLCSK*NYIWIALFAQHVTVYIILHGICRIVYILQ*IKKN*DYF 673 YKN +GC C V+ + C I + +F YII+ GIC I +L IKK Y+ Sbjct: 21 YKNILGCICLVIILAIFCISELAILLGIFMLFAIFYIIITGICAIYILLVGIKKISKYY 79 >UniRef50_Q9PYP9 Cluster: ORF147; n=1; Xestia c-nigrum granulovirus|Rep: ORF147 - Xestia c-nigrum granulosis virus (XnGV) (Xestia c-nigrumgranulovirus) Length = 309 Score = 35.5 bits (78), Expect = 1.3 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 531 TTWQHPTLFLYHN-CHIFKFRIYMIKNQYVYYLLSVMETLVERKVPSIG 388 + W + F+Y++ CH F I Y YY+L +E K+P++G Sbjct: 7 SVWYNKDKFIYNSTCHPFWHNILYYSQYYTYYVLYYVENESSAKIPAVG 55 >UniRef50_A4VDG4 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 2356 Score = 32.7 bits (71), Expect = 8.8 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = -1 Query: 632 QSYIYHVILYKQLRVVQKVRSKYNFIYYIADYAPLHGNTQLCFYTITVIFLN 477 Q+Y+Y +I KQL +++ ++ K+ I Y+ + + L +TIT I LN Sbjct: 106 QNYLYIIIFCKQLEILKFLKLKFLEIIYLQLFIQQY-TKYLILHTITAIILN 156 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,405,271 Number of Sequences: 1657284 Number of extensions: 11040469 Number of successful extensions: 22429 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22424 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -