BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30241 (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 24 1.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.4 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 4.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.5 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 9.6 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 24.2 bits (50), Expect = 1.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = -1 Query: 623 IYHVILYKQLRVVQKVRSKYNFIYYIADYAPLHGNTQLCFYTITVIFLN 477 +Y ++Y LRV + +RS Y Y + + + NT +Y + V LN Sbjct: 21 LYFSVIYSLLRVKRMMRSWY---YLLTNLT--YNNTNRKYYWLNVCCLN 64 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 513 TLFLYHNCHIFKFRIYMIKNQYVYYLLSVMETLVERKVPSIGL 385 T+F +C++ + M+KN+Y+ +L+ +E K S+ L Sbjct: 811 TIFNAAHCYLATELVLMLKNRYI--ILNGRLIKMETKAQSVAL 851 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.2 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -3 Query: 168 DSFRVKKEKLLWLKSVVHTRGSIISTFNFCAFLLHSNL*LSTFSIFLPLNKLL 10 D F + ++ + + + H G + FN L + L L + F+ LNK L Sbjct: 150 DYFVQRNQEYKYYQILSHLSGIFFTVFNVAQCYLTTELVLMLQTRFVILNKQL 202 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 561 IIFGSHFLHNT*LFI*YYMVYVGLCIFY 644 IIF H L ++ Y + + LCI+Y Sbjct: 273 IIFTMHLLFLLCIYYFYCALIILLCIYY 300 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.0 bits (42), Expect = 9.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 607 YINSYVLCKKCDPNIILFTT*RTTLHYMATP 515 YINSY+ N LFT + + +A P Sbjct: 42 YINSYLFSLSLAQNNQLFTHHKAPIRPVALP 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,915 Number of Sequences: 336 Number of extensions: 3465 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -