BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30241 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7618| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.53) 31 0.67 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 31 1.2 SB_14276| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_21415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_47910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_104| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6) 28 8.3 >SB_7618| Best HMM Match : Sulfotransfer_1 (HMM E-Value=0.53) Length = 319 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 540 LRSTTWQHPTLFLYHNCHIF--KFRIYMIKNQYVYYLLSVM 424 ++ +T ++LY NC+ F + + KN YVY+LLS + Sbjct: 120 IQESTPNAKNIYLYRNCYAFVESYIRILAKNYYVYWLLSTL 160 >SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) Length = 458 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -2 Query: 634 HNPTYTM*YYINSYVLCKKCDPNIILFTT*RTTLHYMATP 515 H PT+T+ ++ N +L CD ++++ TT HY+ +P Sbjct: 316 HAPTFTVAWHPNKPLLAFACDDKVLVYYC--TTNHYLPSP 353 >SB_14276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = -3 Query: 474 RIYMIKNQYVYYLLSVMETLVERKVPSIGLKTKIVG---HAQHQLAFESGLV 328 R+ M Q YY ++M + R PSIG K K G + +++ ESG V Sbjct: 142 RLSMCNRQLYYYKPTIMHASLPRGRPSIGTKIKKHGAGSYMSYEIILESGTV 193 >SB_21415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 623 IYHVILYKQLRVVQKVRSKYNFIYYIADYAPLHGNTQLCFYTITVIFLN 477 IY V + LR + K+ YNFI ++ LHGN Y++T ++L+ Sbjct: 90 IYLVEGLENLRKLTKLDLSYNFIENVSGLKDLHGNG----YSLTTLYLH 134 >SB_47910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 524 HVVERSPLCSK*NYIWIALFAQHVTVYIILHGIC 625 + +E+ P+C K IW + V+ Y++ HG C Sbjct: 188 NTIEKYPVCDK-EGIWQTTLQKIVSTYLVHHGYC 220 >SB_104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -3 Query: 540 LRSTTWQHPTLFLYHNCHIFK---FRIYMIKNQYVYYLLS 430 ++ +T +++Y NC+ F R++ ++N YVY+LLS Sbjct: 123 IQESTPNAKNIYIYRNCYAFAESCVRMF-VQNYYVYWLLS 161 >SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6) Length = 526 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 183 LGRAKDSFRVKKEKLLWLKSVVHTRGSIISTFN 85 +GR K F++K L WL+S + R + N Sbjct: 494 IGRLKHRFKIKGSALSWLRSYLSDRSQFVKIGN 526 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,457,553 Number of Sequences: 59808 Number of extensions: 347758 Number of successful extensions: 3887 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3887 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -