BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30241 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 2.3 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.3 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 435 LSVMETLVERKVPSIGLKTKIVGHAQHQLAFESGLVKLQN 316 L V+ TL + LK K +GH H L + LV+ N Sbjct: 262 LYVLVTLQSEAQLAAALKLKTLGHHHHHLPPSTALVQQTN 301 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -3 Query: 177 RAKDSFRVKKEKLLWLKSVVHTRGSIISTFNFCAFLLHS 61 R+ DSF + ++ ++W V RG ++ N+ F H+ Sbjct: 1200 RSMDSFGITRKHVVWRHEFVDGRGRTLT--NYYEFNAHT 1236 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -3 Query: 177 RAKDSFRVKKEKLLWLKSVVHTRGSIISTFNFCAFLLHS 61 R+ DSF + ++ ++W V RG ++ N+ F H+ Sbjct: 1201 RSMDSFGITRKHVVWRHEFVDGRGRTLT--NYYEFNAHT 1237 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,955 Number of Sequences: 2352 Number of extensions: 12294 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -