BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30241 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60770.1 68414.m06841 pentatricopeptide (PPR) repeat-containi... 29 3.9 At2g24510.1 68415.m02928 F-box family protein-related contains T... 28 6.8 At4g39840.1 68417.m05645 expressed protein 27 9.0 >At1g60770.1 68414.m06841 pentatricopeptide (PPR) repeat-containing protein low similarity to DNA-binding protein [Triticum aestivum] GI:6958202; contains Pfam profile PF01535: PPR repeat Length = 491 Score = 28.7 bits (61), Expect = 3.9 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 7/94 (7%) Frame = -3 Query: 507 FLYHNCHIFKFR----IYMIKNQYVYY-LLSVMETLVERKVPSIGLKTKIVGHAQHQ--L 349 FL H+FK+ I ++N+ +YY L + E + ER G+ + A H + Sbjct: 46 FLKGTKHVFKWEVGDTIKKLRNRGLYYPALKLSEVMEER-----GMNKTVSDQAIHLDLV 100 Query: 348 AFESGLVKLQN*TVTFEVFFKLFLIYGQIENCYC 247 A + +N V K L YG + NCYC Sbjct: 101 AKAREITAGENYFVDLPETSKTELTYGSLLNCYC 134 >At2g24510.1 68415.m02928 F-box family protein-related contains TIGRFAM TIGR01640 : F-box protein interaction domain; similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana] Length = 281 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -1 Query: 413 LNEKSLQLV*KLKLWVTLSTNWPLKADWSNYKIRQLHLKFFL 288 L++K L+ ++K+W+T + ++ WSN+ + + KF L Sbjct: 176 LHQKILEFSNEMKIWLTNKIDETIELSWSNFVLTVDYDKFNL 217 >At4g39840.1 68417.m05645 expressed protein Length = 451 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 450 YVYYLLSVMETLVERKVPSIGLKTKIVGHAQHQLAFESGL 331 YV+YLL ++ LV GL K++G AQ + F GL Sbjct: 355 YVFYLLLLLMYLVLVFSTDCGLGLKVLGLAQTFVGFAVGL 394 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,035,840 Number of Sequences: 28952 Number of extensions: 242115 Number of successful extensions: 508 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -