BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30238X (434 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 7e-28 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 1.7 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 1.7 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 1.7 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 1.7 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 2.9 SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) 27 5.0 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 27 8.8 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 120 bits (288), Expect = 7e-28 Identities = 56/71 (78%), Positives = 64/71 (90%), Gaps = 1/71 (1%) Frame = +1 Query: 223 QTREHLLVF-FTIKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 399 +T EH+ +F IKEF+IIDFFLG +L D+VLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 400 HIGLGVKCSKE 432 H+GLGVKCSKE Sbjct: 84 HVGLGVKCSKE 94 Score = 46.4 bits (105), Expect = 1e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 173 WVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 WVPVTKLGRLV+ KI LE IYLFSL K Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIK 37 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 NDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 414 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 2.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 351 TAHTFQGICCHWRQQRSYW 407 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) Length = 174 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 168 KSGFLSPNSAVLFAXEKSTNSRAFTCFLYNQ 260 KSG L ++F E +S+AF C LYN+ Sbjct: 56 KSGRLGGMPNIVFNSEYQWSSKAFLCTLYNK 86 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -3 Query: 429 LAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 316 LA + N+ +V NG K + C LS T L LY HDL Sbjct: 114 LAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,509,882 Number of Sequences: 59808 Number of extensions: 223882 Number of successful extensions: 582 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -