BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30238X (434 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 4.7 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 4.7 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 4.7 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 4.7 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 4.7 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 4.7 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 4.7 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 6.2 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 6.2 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 294 VPE*SSSKDHACTETNTCRTAHTFQGICCH 383 +PE S + +C E CR + Q CH Sbjct: 243 LPELYSYDEQSCIECAECRGLFSPQKFVCH 272 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 22.6 bits (46), Expect = 6.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 179 EPTLSGLPCRAHDHGRDHDRVHEDRRGL 96 EP SG +A D G+ +R H+ +GL Sbjct: 315 EPGRSGEKGQAGDRGQVGERGHKGEKGL 342 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 412,147 Number of Sequences: 2352 Number of extensions: 6980 Number of successful extensions: 22 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -