BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30238X (434 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 93 8e-20 Z74041-9|CAA98523.2| 801|Caenorhabditis elegans Hypothetical pr... 27 5.9 Z74035-5|CAA98485.2| 801|Caenorhabditis elegans Hypothetical pr... 27 5.9 >U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal protein, small subunitprotein 2 protein. Length = 272 Score = 93.1 bits (221), Expect = 8e-20 Identities = 46/59 (77%), Positives = 51/59 (86%) Frame = +1 Query: 256 IKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 IKEF+IID L +L D+VLKI PVQKQT AGQRTRFKAFVAIGD+ GH+GLGVKCSKE Sbjct: 85 IKEFEIIDA-LCSNLKDEVLKISPVQKQTTAGQRTRFKAFVAIGDHAGHVGLGVKCSKE 142 Score = 45.6 bits (103), Expect = 2e-05 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 158 EDQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 E + EW PVTKLGRLV+ KI LE IYL SL K Sbjct: 52 EKETEWTPVTKLGRLVKEKKITTLEEIYLNSLPIK 86 >Z74041-9|CAA98523.2| 801|Caenorhabditis elegans Hypothetical protein F47G9.3 protein. Length = 801 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 378 NKCLETCALSGTCLFLYR-HDL*NLIIQGR 292 ++CLE C +S C F Y+ D+ N +I R Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRR 315 >Z74035-5|CAA98485.2| 801|Caenorhabditis elegans Hypothetical protein F47G9.3 protein. Length = 801 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 378 NKCLETCALSGTCLFLYR-HDL*NLIIQGR 292 ++CLE C +S C F Y+ D+ N +I R Sbjct: 286 SECLEKCTMSEECRFAYQSKDMNNCLISRR 315 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,049,882 Number of Sequences: 27780 Number of extensions: 164286 Number of successful extensions: 432 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 735312162 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -