BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30238X (434 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ri... 109 8e-25 At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) 109 8e-25 At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila... 107 2e-24 At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi... 107 2e-24 At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 107 2e-24 At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila... 107 2e-24 At2g33800.1 68415.m04147 ribosomal protein S5 family protein con... 39 0.002 At5g59520.1 68418.m07459 zinc transporter (ZIP2) identical to zi... 28 2.4 At3g61590.1 68416.m06898 F-box family protein contains weak hit ... 27 4.1 At5g47430.1 68418.m05844 expressed protein 27 7.2 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 27 7.2 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 27 7.2 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 27 7.2 At2g37930.1 68415.m04656 expressed protein 26 9.5 >At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ribosomal protein S2 - Arabidopsis thaliana, SWISSPROT:RS2_ARATH Length = 276 Score = 109 bits (262), Expect = 8e-25 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = +1 Query: 256 IKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 +KE+QIID +GPSL D+V+KIMPVQKQTRAGQRTRFKAF+ +GD+NGH+GLGVKCSKE Sbjct: 73 VKEYQIIDLLVGPSLKDEVMKIMPVQKQTRAGQRTRFKAFIVVGDSNGHVGLGVKCSKE 131 Score = 48.0 bits (109), Expect = 3e-06 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +2 Query: 161 DQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 ++++WVPVTKLGRLV+ KI K+E IYL SL K Sbjct: 41 EEEKWVPVTKLGRLVKEGKITKIEQIYLHSLPVK 74 >At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) Length = 285 Score = 109 bits (262), Expect = 8e-25 Identities = 48/71 (67%), Positives = 58/71 (81%) Frame = +1 Query: 220 RQTREHLLVFFTIKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 399 +Q + L +KE+QIID +GP+L D+V+KIMPVQKQTRAGQRTRFKAFV +GD NG Sbjct: 70 KQIEQIYLHSLPVKEYQIIDMLIGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNG 129 Query: 400 HIGLGVKCSKE 432 H+GLGVKCSKE Sbjct: 130 HVGLGVKCSKE 140 Score = 42.7 bits (96), Expect = 1e-04 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = +2 Query: 161 DQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 ++++WVPVTKLGRLV I ++E IYL SL K Sbjct: 50 EEEKWVPVTKLGRLVAAGHIKQIEQIYLHSLPVK 83 >At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) similar to ribosomal protein S2 GI:430711 from [Drosophila melanogaster] Length = 284 Score = 107 bits (258), Expect = 2e-24 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +1 Query: 256 IKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 +KE+QIID +GP+L D+V+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSKE Sbjct: 81 VKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKE 139 Score = 46.8 bits (106), Expect = 6e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +2 Query: 161 DQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 ++ +WVPVTKLGRLV KI KLE IYL SL K Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVK 82 >At1g58983.1 68414.m06666 40S ribosomal protein S2, putative similar to ribosomal protein S2 GI:939717 from [Urechis caupo] Length = 284 Score = 107 bits (258), Expect = 2e-24 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +1 Query: 256 IKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 +KE+QIID +GP+L D+V+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSKE Sbjct: 81 VKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKE 139 Score = 46.8 bits (106), Expect = 6e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +2 Query: 161 DQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 ++ +WVPVTKLGRLV KI KLE IYL SL K Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVK 82 >At1g58684.1 68414.m06657 40S ribosomal protein S2, putative Length = 284 Score = 107 bits (258), Expect = 2e-24 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +1 Query: 256 IKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 +KE+QIID +GP+L D+V+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSKE Sbjct: 81 VKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKE 139 Score = 46.8 bits (106), Expect = 6e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +2 Query: 161 DQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 ++ +WVPVTKLGRLV KI KLE IYL SL K Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVK 82 >At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) similar to ribosomal protein S2 GI:939717 from (Urechis caupo) Length = 284 Score = 107 bits (258), Expect = 2e-24 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +1 Query: 256 IKEFQIIDFFLGPSLNDQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 +KE+QIID +GP+L D+V+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSKE Sbjct: 81 VKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKE 139 Score = 46.8 bits (106), Expect = 6e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +2 Query: 161 DQKEWVPVTKLGRLVRXXKIDKLESIYLFSLQSK 262 ++ +WVPVTKLGRLV KI KLE IYL SL K Sbjct: 49 EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVK 82 >At2g33800.1 68415.m04147 ribosomal protein S5 family protein contains Pfam profiles PF03719: Ribosomal protein S5, C-terminal domain, PF00333: Ribosomal protein S5, N-terminal domain Length = 303 Score = 38.7 bits (86), Expect = 0.002 Identities = 14/43 (32%), Positives = 29/43 (67%) Frame = +1 Query: 304 DQVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKE 432 ++V+++ V K + G++ +F+A V +GD G++G+G +KE Sbjct: 149 ERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQGNVGVGCAKAKE 191 >At5g59520.1 68418.m07459 zinc transporter (ZIP2) identical to zinc transporter ZIP2 [Arabidopsis thaliana] gi|3252868|gb|AAC24198; member of the Zinc (Zn2+)-Iron (Fe2+) permease (ZIP) family, PMID:11500563 Length = 353 Score = 28.3 bits (60), Expect = 2.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 370 AFVAIGDNNGHIGLGVKCSKE 432 AFVA G NN H+G V S+E Sbjct: 149 AFVAAGSNNNHVGASVGESRE 169 >At3g61590.1 68416.m06898 F-box family protein contains weak hit to Pfam PF00646: F-box domain; stamina pistilloidia (Stp) - Pisum sativum, EMBL:AF004843 Length = 411 Score = 27.5 bits (58), Expect = 4.1 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +3 Query: 3 LSEPIVQQWRTLLQP 47 +S PI +QWRTL++P Sbjct: 150 VSNPITKQWRTLIEP 164 >At5g47430.1 68418.m05844 expressed protein Length = 879 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -1 Query: 143 DHGRDHDRVHEDRRGLYLHRVIRIRRENRHVHRLEQRPP 27 +H R DR EDR + H R H HR PP Sbjct: 718 EHDRTRDRRDEDRSRDHRHHRGETERSQHH-HRKRSEPP 755 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 134 RDHDRVHEDRRGLYLHRVIRIRRENRHVHRLEQRPP 27 RDHDR +DR G R R R ++R R R P Sbjct: 130 RDHDRRRDDRGGRRSRR-SRSRSKDRSERRTRSRSP 164 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 134 RDHDRVHEDRRGLYLHRVIRIRRENRHVHRLEQRPP 27 RDHDR +DR G R R R ++R R R P Sbjct: 130 RDHDRRRDDRGGRRSRR-SRSRSKDRSERRTRSRSP 164 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 134 RDHDRVHEDRRGLYLHRVIRIRRENRHVHRLEQRPP 27 RDHDR +DR G R R R ++R R R P Sbjct: 130 RDHDRRRDDRGGRRSRR-SRSRSKDRSERRTRSRSP 164 >At2g37930.1 68415.m04656 expressed protein Length = 467 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 190 TRPSCSXXKNRQTREHLLVFFTI-KEFQIIDFFLGPSLNDQVLKIM 324 TRP K +R H L+ FT+ K + F +G + N+ + M Sbjct: 196 TRPPTKEKKQSSSRVHALLQFTLRKGINLFQFVVGDNSNNVLAATM 241 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,525,020 Number of Sequences: 28952 Number of extensions: 153071 Number of successful extensions: 379 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -