BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30237 (815 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.04 |||flavonol reductase/cinnamoyl-CoA reductase family... 29 0.60 SPAC24B11.11c |sid2||Sid2p-Mob1p kinase complex|Schizosaccharomy... 29 0.79 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 28 1.8 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 27 3.2 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 26 5.6 >SPBC1773.04 |||flavonol reductase/cinnamoyl-CoA reductase family|Schizosaccharomyces pombe|chr 2|||Manual Length = 336 Score = 29.5 bits (63), Expect = 0.60 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 357 FF*QVYSQRYEVSPEFRFVNY 295 FF Q+ RYEV+PE +F NY Sbjct: 218 FFWQLIKGRYEVAPESKFFNY 238 >SPAC24B11.11c |sid2||Sid2p-Mob1p kinase complex|Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 29.1 bits (62), Expect = 0.79 Identities = 18/70 (25%), Positives = 35/70 (50%) Frame = +2 Query: 548 KQFDRKFDRLGVYDKGNLHRSSSE*YCSVDRRSKCCCSELLFNMQAYLENVVRFRHLTLL 727 K+FD R G+++ GNL + E D+ + S + + + Y +N + +H++ L Sbjct: 24 KKFDAYMKRHGLFEPGNLSNNDKERNLE-DQFNSMKLSPVASSKENYPDNHMHSKHISKL 82 Query: 728 AVGPLVSPRG 757 + + PRG Sbjct: 83 PIASPI-PRG 91 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = +3 Query: 54 SHDFSCVQAAPSNYKTLSRQKLFIQGCHKPFYHYEFTPTVQNT*GLDYFEINLSY 218 SH F C+ + S Y +S + + + + +HY T+ + F + L+Y Sbjct: 532 SHRFPCIFTSFSCYNCISGTRKYSRQYSRDKFHYNQRTTIYYLVAISIFALGLTY 586 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 27.1 bits (57), Expect = 3.2 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 639 RSTEQYHSLDDR*RFPLSYTPKRS 568 R+++++ D + R+PLS TPK+S Sbjct: 608 RTSQRFFKSDGKVRYPLSNTPKKS 631 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.2 bits (55), Expect = 5.6 Identities = 13/55 (23%), Positives = 24/55 (43%) Frame = +3 Query: 54 SHDFSCVQAAPSNYKTLSRQKLFIQGCHKPFYHYEFTPTVQNT*GLDYFEINLSY 218 SH F C+ + S Y +S + + + +HY T+ + F + L+Y Sbjct: 532 SHRFPCIFTSFSCYNCISGTRNISRQYSRDKFHYNQRTTIYYLVAISIFALGLTY 586 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,161,766 Number of Sequences: 5004 Number of extensions: 63117 Number of successful extensions: 128 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -