BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30237 (815 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32682-4|CAA83612.1| 218|Caenorhabditis elegans Hypothetical pr... 31 0.75 Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr... 29 3.0 Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p... 29 3.0 >Z32682-4|CAA83612.1| 218|Caenorhabditis elegans Hypothetical protein M04D8.4 protein. Length = 218 Score = 31.5 bits (68), Expect = 0.75 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 584 IPPNDRISDRIVLLLIITSPKYAYY 510 IP +DR++D+IV+L I P Y Y+ Sbjct: 79 IPVSDRVTDKIVILCYIAVPVYIYF 103 >Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical protein ZK945.9 protein. Length = 3178 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 671 IKVPNNNIWTVGLLSNITRSMTDEDSLYRIPPNDRISDRIVLLLIITSPKYAYY 510 +K+ +N + L +N+ + + DSLY + P+D D IV + +TS ++A Y Sbjct: 1729 LKIALDNPLSSDLAANLKYATDNYDSLYNVLPSD--PDNIVYVEEMTSEEWAAY 1780 >Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical protein ZK945.9 protein. Length = 3178 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -1 Query: 671 IKVPNNNIWTVGLLSNITRSMTDEDSLYRIPPNDRISDRIVLLLIITSPKYAYY 510 +K+ +N + L +N+ + + DSLY + P+D D IV + +TS ++A Y Sbjct: 1729 LKIALDNPLSSDLAANLKYATDNYDSLYNVLPSD--PDNIVYVEEMTSEEWAAY 1780 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,152,278 Number of Sequences: 27780 Number of extensions: 332726 Number of successful extensions: 652 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2008899418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -