BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30237 (815 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23050.2 68417.m03324 protein kinase, putative similar to MAP... 29 2.8 At4g23050.1 68417.m03323 protein kinase, putative similar to MAP... 29 2.8 At3g10800.1 68416.m01300 bZIP transcription factor family protei... 28 8.5 >At4g23050.2 68417.m03324 protein kinase, putative similar to MAP3K delta-1 protein kinase [Arabidopsis thaliana] gi|2253010|emb|CAA74591; contains Pfam PF00069 Protein kinase domain and PF00989 PAS domain Length = 736 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 124 MKSF*RDNVL*FDGAACTHEKS*LMRRYL 38 MK NVL F GA CT EKS ++ Y+ Sbjct: 517 MKKLRHPNVLLFMGAVCTEEKSAIIMEYM 545 >At4g23050.1 68417.m03323 protein kinase, putative similar to MAP3K delta-1 protein kinase [Arabidopsis thaliana] gi|2253010|emb|CAA74591; contains Pfam PF00069 Protein kinase domain and PF00989 PAS domain Length = 735 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 124 MKSF*RDNVL*FDGAACTHEKS*LMRRYL 38 MK NVL F GA CT EKS ++ Y+ Sbjct: 516 MKKLRHPNVLLFMGAVCTEEKSAIIMEYM 544 >At3g10800.1 68416.m01300 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 617 RSMTDEDSLYRIPPNDRISDRIVLLLIITSPKYAYY 510 R + D ++ +PPN + RI +++++ S KY Y Sbjct: 626 REVVDSETDRVVPPNPKSLSRIFVVVLLDSVKYVTY 661 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,774,337 Number of Sequences: 28952 Number of extensions: 299205 Number of successful extensions: 564 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -