BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CF9A4 Cluster: hypothetical protein TTHERM_0041... 32 7.4 UniRef50_Q91ES6 Cluster: ORF129; n=1; Cydia pomonella granulovir... 32 7.4 UniRef50_Q9W3R6 Cluster: CG2079-PA; n=3; Diptera|Rep: CG2079-PA ... 32 7.4 UniRef50_A2EKJ8 Cluster: Putative uncharacterized protein; n=1; ... 31 9.8 UniRef50_Q6BJQ1 Cluster: Similar to CA2603|IPF5471 Candida albic... 31 9.8 UniRef50_Q96T58 Cluster: Msx2-interacting protein; n=14; Eutheri... 31 9.8 >UniRef50_UPI00006CF9A4 Cluster: hypothetical protein TTHERM_00419990; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00419990 - Tetrahymena thermophila SB210 Length = 1468 Score = 31.9 bits (69), Expect = 7.4 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 262 DEQNDFKKERDYPTLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQ 405 + N + K + + + ++RR Q N YQ R+ R D+YQN + Sbjct: 836 NNNNYYNKNKHFKKYDNYKRRNSQSNERGGYQYGRYQNYRHDHYQNNR 883 >UniRef50_Q91ES6 Cluster: ORF129; n=1; Cydia pomonella granulovirus|Rep: ORF129 - Cydia pomonella granulosis virus (CpGV) (Cydia pomonellagranulovirus) Length = 128 Score = 31.9 bits (69), Expect = 7.4 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 131 IFVRNSTRSKMNKFTLVLGFLLLIAVVN 214 +FV N+ R K NK+ VL FLL +VN Sbjct: 100 LFVNNACREKYNKYLFVLVFLLCAQIVN 127 >UniRef50_Q9W3R6 Cluster: CG2079-PA; n=3; Diptera|Rep: CG2079-PA - Drosophila melanogaster (Fruit fly) Length = 622 Score = 31.9 bits (69), Expect = 7.4 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +1 Query: 301 TLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFRLLYELAVEVRRQPPP 474 +LNR +++ Y ++ RH R + ++++D P+IF L E V++ ++PPP Sbjct: 21 SLNRISKKKACSRYCLLFKASRHGIARLEMCESKEDRNPKIFTL--ENCVKITQEPPP 76 >UniRef50_A2EKJ8 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 188 Score = 31.5 bits (68), Expect = 9.8 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 271 NDFKKERDYPTLNRHRRRRWQLNYGY----DYQPPRHYTERRDY-YQNQQD 408 ND+ + +Y NR R RR + Y Y DY R Y++RRD Y +++D Sbjct: 124 NDYYSDDEY---NRDRERRGRRRYDYSSDDDYDYHRRYSDRRDVRYMDRRD 171 >UniRef50_Q6BJQ1 Cluster: Similar to CA2603|IPF5471 Candida albicans IPF5471 of unknown function; n=1; Debaryomyces hansenii|Rep: Similar to CA2603|IPF5471 Candida albicans IPF5471 of unknown function - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 506 Score = 31.5 bits (68), Expect = 9.8 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +2 Query: 206 VVNARHYGDRRDSGSSEMMTNKTTSRK 286 ++ RHYGD+ +SG S++ ++K++ K Sbjct: 335 IIGTRHYGDKANSGHSKLFSSKSSMSK 361 >UniRef50_Q96T58 Cluster: Msx2-interacting protein; n=14; Eutheria|Rep: Msx2-interacting protein - Homo sapiens (Human) Length = 3664 Score = 31.5 bits (68), Expect = 9.8 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 289 RDYPTLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFR 429 RDYP R W+ G DY R+Y + R+Y + D Q R Sbjct: 648 RDYPARGREFYSEWETYQG-DYYESRYYDDPREYRDYRNDPYEQDIR 693 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 401,375,476 Number of Sequences: 1657284 Number of extensions: 7478253 Number of successful extensions: 17743 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17730 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 26450695845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -