BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.19 |||ATPase with bromodomain protein|Schizosaccharomyc... 29 0.27 SPAC22F8.10c |sap145||U2 snRNP-associated protein Sap145 |Schizo... 29 0.36 SPBC1703.01c ||SPBP4H10.22c|RNase P and RNase MRP subunit|Schizo... 26 3.4 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 25 5.9 SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces po... 25 5.9 SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 25 7.8 SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosacchar... 25 7.8 >SPAC31G5.19 |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1190 Score = 29.5 bits (63), Expect = 0.27 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -3 Query: 415 ESDPVGFDSSLFSRYNVGEVDNHIRNL 335 +SDP+G DSSL S +VG +DN+I L Sbjct: 253 DSDPLGVDSSL-SFESVGGLDNYINQL 278 >SPAC22F8.10c |sap145||U2 snRNP-associated protein Sap145 |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 29.1 bits (62), Expect = 0.36 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 361 PRHYTERRDYYQNQQDLIPQIFRL 432 PRH+ ++RDY Q+ + Q+F L Sbjct: 228 PRHWNQKRDYLSGQRGIERQLFEL 251 >SPBC1703.01c ||SPBP4H10.22c|RNase P and RNase MRP subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 217 Score = 25.8 bits (54), Expect = 3.4 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 191 LLLIAVVNARHYGDRRDSGSSEMMTNKTTSRKKEI 295 LLL+ +N GDR++S +S+ ++ KK++ Sbjct: 48 LLLVPSLNLEKQGDRKESVASKKRKKLSSKEKKKL 82 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 25.0 bits (52), Expect = 5.9 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +1 Query: 391 YQNQQDLIPQIFRLLYELAVE-VRRQPPP 474 +Q +DLIP++ LL L ++ + +PPP Sbjct: 253 FQTYKDLIPKMLPLLAPLVLQFISLRPPP 281 >SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 897 Score = 25.0 bits (52), Expect = 5.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 226 WRQKRLWKF 252 WRQKRLW F Sbjct: 90 WRQKRLWSF 98 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 24.6 bits (51), Expect = 7.8 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 391 SSLFSRYNVGEVDNHIRNLVAISSYGVCLGSGNLFLS*SRFVRH 260 +S S +GE +NH R + + + G N+ + FVRH Sbjct: 126 NSSISDIRIGEKNNHYRIVFSSVDNSLVKGPSNVHVYDHLFVRH 169 >SPAC1093.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 24.6 bits (51), Expect = 7.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 471 WWLPPYLNSELVKQSKY 421 WW P Y+N EL ++ Y Sbjct: 576 WWTPVYVNQELRCKNAY 592 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,671,320 Number of Sequences: 5004 Number of extensions: 31536 Number of successful extensions: 66 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -