BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0660 - 24071523-24071780,24071873-24072127,24072209-240723... 28 4.4 04_03_0869 + 20421368-20421548,20421781-20422664,20422747-204229... 27 5.8 04_04_0404 - 24952444-24953094 27 7.7 >01_05_0660 - 24071523-24071780,24071873-24072127,24072209-24072380, 24072458-24072685,24072785-24072918,24073005-24073088, 24073231-24073521,24073599-24073931,24074016-24074266, 24074354-24074620,24074707-24074867,24074978-24075294, 24075386-24075667,24075753-24076054,24076147-24076237, 24076326-24076379,24076497-24076573,24076700-24076859, 24077129-24077213,24077421-24077630,24077736-24078097 Length = 1457 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 170 FTLVLGFLLLIAVVNARHYGDRRDSGSSEMMTNKTTSRKKEI 295 FT++ L +A+ R YG+ R S S E + K + EI Sbjct: 773 FTILFNALFTLALTYLRPYGNSRQSVSEEELKEKRANLNGEI 814 >04_03_0869 + 20421368-20421548,20421781-20422664,20422747-20422905, 20423008-20423252,20423360-20423453,20423580-20423768 Length = 583 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 331 QLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 420 +L GY +QPP+H+ YY+ L Q Sbjct: 45 KLRTGYHFQPPKHWINGPMYYKGLYHLFYQ 74 >04_04_0404 - 24952444-24953094 Length = 216 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 206 VVNARHYGDRRDSGSSEMMTNKTTSRKKEI 295 VV A YG+RR S ++ ++ T ++KE+ Sbjct: 126 VVRAVEYGERRGSPAAPLLLTVTEGKEKEV 155 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,070,583 Number of Sequences: 37544 Number of extensions: 209836 Number of successful extensions: 486 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -