BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 30 1.1 SB_46154| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-27) 29 2.6 SB_52683| Best HMM Match : BCNT (HMM E-Value=3) 27 7.9 SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) 27 7.9 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 340 YGYDYQPPRHYTE-RRDYYQNQQDLIPQIF 426 Y Y Y+ PRHYTE R + + N D+ +F Sbjct: 750 YSYLYELPRHYTECRTELWLNNTDMRGSVF 779 >SB_46154| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-27) Length = 799 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 295 YPTLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQ 396 Y TLN+ R+ Y Y+YQ + DYYQ Sbjct: 413 YSTLNQEHRQNRNDYYSYNYQRASSESRSFDYYQ 446 >SB_52683| Best HMM Match : BCNT (HMM E-Value=3) Length = 225 Score = 27.1 bits (57), Expect = 7.9 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 247 KF*DDDEQNDFKKERDYPTLNRHRRRRWQLNYGYDYQPPRHYTER-RDYYQNQQD 408 ++ D D D+ ++RDY +R+ R + YD R+Y +R RDY +D Sbjct: 131 RYRDQDRDRDYDRDRDYDDRDRYYDDR---DRYYD-DRDRYYDDRDRDYDDRDRD 181 >SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) Length = 197 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = -3 Query: 355 DNHIRNLVAISSYGVCLGSGNLFLS*SRFVRHHLRTS 245 D+H +N + SS+ +C+G+ +S +++ H+ TS Sbjct: 27 DHHFKNATSPSSHTICVGTTLEGVSVQKYLGVHISTS 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,843,542 Number of Sequences: 59808 Number of extensions: 251079 Number of successful extensions: 545 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -