BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061397-1|AAL28945.1| 622|Drosophila melanogaster LD32155p pro... 32 0.46 AE014298-1030|AAF46253.1| 622|Drosophila melanogaster CG2079-PA... 32 0.46 L14849-1|AAA28748.1| 548|Drosophila melanogaster tyrosine phosp... 27 9.8 L11253-1|AAA75339.1| 548|Drosophila melanogaster protein ( D.me... 27 9.8 L11252-1|AAA75338.1| 535|Drosophila melanogaster protein ( D.me... 27 9.8 L11251-1|AAA75349.1| 535|Drosophila melanogaster protein ( D.me... 27 9.8 L11250-1|AAA75348.1| 548|Drosophila melanogaster protein ( D.me... 27 9.8 AY069713-1|AAL39858.1| 530|Drosophila melanogaster LP01280p pro... 27 9.8 AE014296-244|AAN11476.1| 431|Drosophila melanogaster CG9181-PD,... 27 9.8 AE014296-243|AAF47487.1| 548|Drosophila melanogaster CG9181-PA,... 27 9.8 AE014296-242|AAF47486.1| 535|Drosophila melanogaster CG9181-PB,... 27 9.8 AE014296-241|AAN11475.1| 530|Drosophila melanogaster CG9181-PC,... 27 9.8 AE013599-3720|AAM68275.2| 489|Drosophila melanogaster CG11184-P... 27 9.8 >AY061397-1|AAL28945.1| 622|Drosophila melanogaster LD32155p protein. Length = 622 Score = 31.9 bits (69), Expect = 0.46 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +1 Query: 301 TLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFRLLYELAVEVRRQPPP 474 +LNR +++ Y ++ RH R + ++++D P+IF L E V++ ++PPP Sbjct: 21 SLNRISKKKACSRYCLLFKASRHGIARLEMCESKEDRNPKIFTL--ENCVKITQEPPP 76 >AE014298-1030|AAF46253.1| 622|Drosophila melanogaster CG2079-PA protein. Length = 622 Score = 31.9 bits (69), Expect = 0.46 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +1 Query: 301 TLNRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFRLLYELAVEVRRQPPP 474 +LNR +++ Y ++ RH R + ++++D P+IF L E V++ ++PPP Sbjct: 21 SLNRISKKKACSRYCLLFKASRHGIARLEMCESKEDRNPKIFTL--ENCVKITQEPPP 76 >L14849-1|AAA28748.1| 548|Drosophila melanogaster tyrosine phosphatase protein. Length = 548 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >L11253-1|AAA75339.1| 548|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase mRNA, complete cds. ). Length = 548 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >L11252-1|AAA75338.1| 535|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase mRNA, complete cds. ). Length = 535 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >L11251-1|AAA75349.1| 535|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase gene, complete cds. ). Length = 535 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >L11250-1|AAA75348.1| 548|Drosophila melanogaster protein ( D.melanogaster proteintyrosine phosphatase gene, exons 2-6 and complete cds.). Length = 548 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >AY069713-1|AAL39858.1| 530|Drosophila melanogaster LP01280p protein. Length = 530 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 408 DDDDEDDTDEDEEYETINEH 427 >AE014296-244|AAN11476.1| 431|Drosophila melanogaster CG9181-PD, isoform D protein. Length = 431 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 296 DDDDEDDTDEDEEYETINEH 315 >AE014296-243|AAF47487.1| 548|Drosophila melanogaster CG9181-PA, isoform A protein. Length = 548 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >AE014296-242|AAF47486.1| 535|Drosophila melanogaster CG9181-PB, isoform B protein. Length = 535 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 413 DDDDEDDTDEDEEYETINEH 432 >AE014296-241|AAN11475.1| 530|Drosophila melanogaster CG9181-PC, isoform C protein. Length = 530 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +1 Query: 256 DDDEQNDFKKERDYPTLNRH 315 DDD+++D ++ +Y T+N H Sbjct: 408 DDDDEDDTDEDEEYETINEH 427 >AE013599-3720|AAM68275.2| 489|Drosophila melanogaster CG11184-PC, isoform C protein. Length = 489 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 322 RRWQLNYGYDYQPPRHYTERRDYYQ 396 RR + G Y PPRH+T D Y+ Sbjct: 407 RRIRNKVGLTYYPPRHFTNPLDVYR 431 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,587,949 Number of Sequences: 53049 Number of extensions: 365984 Number of successful extensions: 956 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1622204766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -