BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13642-4|AAG00043.2| 687|Caenorhabditis elegans Hypothetical pr... 28 3.0 Z71180-3|CAA94892.2| 763|Caenorhabditis elegans Hypothetical pr... 27 9.1 M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical pr... 27 9.1 M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical pr... 27 9.1 AL021474-7|CAA16311.2| 763|Caenorhabditis elegans Hypothetical ... 27 9.1 >U13642-4|AAG00043.2| 687|Caenorhabditis elegans Hypothetical protein ZC395.8 protein. Length = 687 Score = 28.3 bits (60), Expect = 3.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 307 NRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQ 405 NR+ RW N DY PR+Y+ R + +NQ+ Sbjct: 600 NRNYDERWSRN---DYSNPRNYSNRSFHQRNQR 629 >Z71180-3|CAA94892.2| 763|Caenorhabditis elegans Hypothetical protein F22E12.1 protein. Length = 763 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 214 INNRYKQQEPKN*GEFIHLGTRAISDKNN 128 + R+K Q+ K IHLGTR S N+ Sbjct: 286 MKRRFKMQKKKLPPRMIHLGTRPASQSNS 314 >M98552-4|AAP68923.1| 1353|Caenorhabditis elegans Hypothetical protein ZK370.4b protein. Length = 1353 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 319 RRRWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFRLLYEL 444 R+ + N +PP+ + E D + Q+L P+IF +L+ L Sbjct: 204 RQNQENNKDTRVRPPQEFFEPTDLPEIPQNLQPEIFYILHNL 245 >M98552-3|AAP68922.1| 1342|Caenorhabditis elegans Hypothetical protein ZK370.4a protein. Length = 1342 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 319 RRRWQLNYGYDYQPPRHYTERRDYYQNQQDLIPQIFRLLYEL 444 R+ + N +PP+ + E D + Q+L P+IF +L+ L Sbjct: 204 RQNQENNKDTRVRPPQEFFEPTDLPEIPQNLQPEIFYILHNL 245 >AL021474-7|CAA16311.2| 763|Caenorhabditis elegans Hypothetical protein F22E12.1 protein. Length = 763 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 214 INNRYKQQEPKN*GEFIHLGTRAISDKNN 128 + R+K Q+ K IHLGTR S N+ Sbjct: 286 MKRRFKMQKKKLPPRMIHLGTRPASQSNS 314 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,371,215 Number of Sequences: 27780 Number of extensions: 183231 Number of successful extensions: 460 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 860942358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -