BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30236X (474 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09700.1 68417.m01594 hypothetical protein similar to zinc fi... 31 0.53 At4g31040.1 68417.m04408 proton extrusion protein-related contai... 30 0.70 At1g61000.1 68414.m06868 Nuf2 family protein contains Pfam PF038... 30 0.70 At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila... 29 1.2 At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila... 29 1.2 At3g62830.1 68416.m07059 NAD-dependent epimerase/dehydratase fam... 27 4.9 At3g28770.1 68416.m03591 expressed protein 27 4.9 At5g42660.1 68418.m05197 expressed protein contains Pfam profile... 27 8.6 >At4g09700.1 68417.m01594 hypothetical protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 371 Score = 30.7 bits (66), Expect = 0.53 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +1 Query: 259 DDEQNDFKKERDYPTLNRHRRRRWQLNYG------YDYQPPRHYTERRDYYQNQQDLIP 417 + ++D +++ DYP+ HR R + ++ DY P Y RRD ++ DL P Sbjct: 275 NSRRSDHREKSDYPSAYSHRHREPRRDFSPQDCSRRDYSRPASYNFRRDSVRSGFDLHP 333 >At4g31040.1 68417.m04408 proton extrusion protein-related contains weak similarity to Proton extrusion protein pcxA (Swiss-Prot:P75028) [Synechocystis sp.] Length = 438 Score = 30.3 bits (65), Expect = 0.70 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 199 YSGC*CTALW--RQKRLWKF*DDDEQNDFKKERDYPTLNRHRRRRWQLNYGYD 351 Y C +LW R+K+LW+F E+N+ + N RRR W + +D Sbjct: 33 YKPCDSISLWGKRRKKLWRFVPSAEKNN-----SHTGNNNKRRRSWWQRFFFD 80 >At1g61000.1 68414.m06868 Nuf2 family protein contains Pfam PF03800: Nuf2 family domain; similar to Myosin-like protein NUF2 (Nuclear filament-containing protein 2) (Nuclear division protein nuf2) (Swiss-Prot:Q10173) [Schizosaccharomyces pombe] Length = 974 Score = 30.3 bits (65), Expect = 0.70 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 265 RHHLRTSRVSSVAIMPCINNRYKQ 194 RH++RT+ VS A PC NR++Q Sbjct: 584 RHNIRTANVSISARHPCFGNRWQQ 607 >At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicases Length = 505 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 328 WQLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 420 +Q GY PP Y +R +Y QN Q Q Sbjct: 24 YQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQ 54 >At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicases Length = 505 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 328 WQLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 420 +Q GY PP Y +R +Y QN Q Q Sbjct: 24 YQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQ 54 >At3g62830.1 68416.m07059 NAD-dependent epimerase/dehydratase family protein similar to UDP-glucuronic acid decarboxylase Uxs1p from Filobasidiella neoformans GI:14318327; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family; contains non-consensus CA donor splice site at exon 1 and TA acceptor splice site at exon 2 Length = 445 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 167 KFTLVLGFLLLIAVVNARHYGDRRDSGSSEMMTNKTTS 280 K +L G L++ R +GD+++ S+ T KTTS Sbjct: 407 KVSLRQGLPLMVKDFRQRVFGDQKEGSSAAATTTKTTS 444 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 27.5 bits (58), Expect = 4.9 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 236 RDSGSSE-MMTNKTTSRKKEITRP*TDTVGGDGN*ITDMIINLPDIIP 376 +D GS+E M N+TT +I TDT +T I NL + P Sbjct: 1852 QDVGSNENSMNNQTTGTGDDIISTTTDTESNTSKEVTSFISNLEEKSP 1899 >At5g42660.1 68418.m05197 expressed protein contains Pfam profile PF04765: Protein of unknown function (DUF616) Length = 463 Score = 26.6 bits (56), Expect = 8.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 259 DDEQNDFKKERDYPTLNRHRRRRWQLNYGYDYQPPRH 369 DDE ND + R R RR+R ++++ Y+ PRH Sbjct: 13 DDESNDLNRIRA-----RTRRKRKKVSHRTSYELPRH 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,822,100 Number of Sequences: 28952 Number of extensions: 170067 Number of successful extensions: 394 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -