BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30235 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 1.9 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 23 3.3 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 343 KCTLGVLDPKLGAAISEALEIQCTHTGAVPEILRGIRYH 459 KC G + P+ I+E L C++ G + + YH Sbjct: 285 KCPPGFVGPRCEGDINECLSNPCSNAGTLDCVQLVNDYH 323 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 404 FSARIQEQSRRF*EAYVITSTRSSKVLPS 490 F +QE + F YV++ T S+ LPS Sbjct: 156 FVKLLQEMKQAFGSKYVLSVTVSANPLPS 184 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 454 YHFHSLIKGLTLKACSVARLALATHTH 534 Y F LIKG+ + R L TH H Sbjct: 356 YDFELLIKGVYQVNPTKTRTNLPTHRH 382 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,804 Number of Sequences: 336 Number of extensions: 3648 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -