BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30235 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37342| Best HMM Match : NOSIC (HMM E-Value=5.4e-33) 134 5e-32 SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26443| Best HMM Match : Trypsin (HMM E-Value=3e-22) 30 2.2 SB_3535| Best HMM Match : WD40 (HMM E-Value=3.2) 29 2.9 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_37342| Best HMM Match : NOSIC (HMM E-Value=5.4e-33) Length = 300 Score = 134 bits (325), Expect = 5e-32 Identities = 59/73 (80%), Positives = 68/73 (93%) Frame = +3 Query: 510 LGLGHSYSRARVKFNVHRVDNMIIPSIALLDQLDKDVNTFSMRIREWYSYHFPELVSIVP 689 LGLGHSYSRA+VKFN+HRVDNMII SIALLDQLDKD+NTFSMRIREWYSYHFPELV IV Sbjct: 80 LGLGHSYSRAKVKFNIHRVDNMIIQSIALLDQLDKDINTFSMRIREWYSYHFPELVKIVN 139 Query: 690 ENHLYTKCAEFMK 728 +N++Y K A+++K Sbjct: 140 DNYMYAKVAKYIK 152 Score = 82.6 bits (195), Expect = 3e-16 Identities = 41/80 (51%), Positives = 52/80 (65%) Frame = +1 Query: 280 ILPEDLNLFLEGGLPKRKKRSKCTLGVLDPKLGAAISEALEIQCTHTGAVPEILRGIRYH 459 I+ +DL F+E +P KK+SK LGV D K+GAAI E+L I C G + E+LRGIR H Sbjct: 3 IIHDDLKAFVEANVPTGKKKSKVLLGVADSKIGAAIQESLNICCDSGGVILEVLRGIRMH 62 Query: 460 FHSLIKGLTLKACSVARLAL 519 F +IKGLT S A+L L Sbjct: 63 FDKMIKGLTGAMASKAQLGL 82 >SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = +3 Query: 531 SRARVKFNVHRVDNMIIPSIALLDQLDKDVNTFSMRIREWYSYHFPELVSIVPENHLYTK 710 SR ++KF+ +VD MI+ +I+LLD LDK++N + MR REWY +HFPEL IV +N Y K Sbjct: 58 SRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYVMRCREWYGWHFPELGKIVTDNLAYAK 117 Query: 711 CAEFM 725 + M Sbjct: 118 TVKKM 122 >SB_26443| Best HMM Match : Trypsin (HMM E-Value=3e-22) Length = 231 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 470 SSKVLPSKRAVWHAWPWPLILTSSCQVQCSPS 565 SS+V+ A HAWPW + L ++ Q C S Sbjct: 35 SSRVVNGANAPQHAWPWQISLRTNGQHICGGS 66 >SB_3535| Best HMM Match : WD40 (HMM E-Value=3.2) Length = 231 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 176 VTDLQRFNAVVTLIAFQPHKSAIVALEISTRYLKVF 283 VT L R+N+ VT +AFQP K+ +A+ + R + V+ Sbjct: 2 VTTLPRYNSAVTAMAFQP-KTNHLAMVCANRQIYVY 36 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 458 TSTRSSKVLPSKRAVWHAWPWPLILTSSCQVQCSPS 565 T S+V+ K A+ AWPW + L S C S Sbjct: 470 TPITQSRVIGGKDAIPGAWPWQIALKSRGNFICGGS 505 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,831,529 Number of Sequences: 59808 Number of extensions: 489999 Number of successful extensions: 1222 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1221 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -