BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30235 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 1.4 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 25 3.2 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 24 4.2 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 4.2 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 24 5.5 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 5.5 AY330176-1|AAQ16282.1| 179|Anopheles gambiae odorant-binding pr... 23 7.3 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 7.3 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 7.3 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 9.7 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 9.7 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.8 bits (54), Expect = 1.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 302 RFKSSGRIPSDTALIFPKQRSPTCVVEKLLKSQQH*NVANLSRTLR 165 R + IPS P +++P +++ L+ Q+ A LSRT R Sbjct: 451 RIEPPAAIPSQEVRKRPPEKNPKEEIDEELEEQRQRKEAGLSRTAR 496 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 342 KMHTRCTGSQARSSHQRGLGNSVHAYRSSPGDFERHTLSL 461 K HT CTG S+ + G N + + +F T SL Sbjct: 59 KHHTHCTGLSRDSTRELGRNNQLLWLCKNCNEFRNGTNSL 98 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 139 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 191 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 139 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 191 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 139 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 191 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 139 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 191 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 139 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 191 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 139 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 191 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 222 FNHTSRRSLLWKYQRGI*RYSS*GFESIPRRGSSKKEETVKMHTRCTGSQARS 380 F H ++ + QRGI R+ R+ + +E + T GSQ RS Sbjct: 259 FRHVVMDTITQREQRGIVRHDMINLLMQARKQELRFDENENIETNGGGSQKRS 311 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 161 EAGK-PLTLQIQQRGTTQSPRCVRITH 84 EAG+ P + +++RG SPR VR H Sbjct: 1111 EAGEAPPPIPMRRRGLPPSPRTVRARH 1137 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 481 LTLKACSVARLALATHTHELVSSSMFTEWTT*SYHQ*PCSI 603 LTL AC+V + T V S F +++ S+ PC + Sbjct: 14 LTLLACTVTGAKVRFATGSRVQSKNFKLYSSLSFFPPPCRV 54 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 166 RRVRDRFATF*CCCDFN 216 RRV DRF+ CCC F+ Sbjct: 139 RRV-DRFSKIYCCCHFS 154 >AY330176-1|AAQ16282.1| 179|Anopheles gambiae odorant-binding protein AgamOBP49 protein. Length = 179 Score = 23.4 bits (48), Expect = 7.3 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +1 Query: 202 CCDFNSFSTTQVGDRCF 252 CC + ST +V ++C+ Sbjct: 41 CCRYEPISTEEVAEKCY 57 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.4 bits (48), Expect = 7.3 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +1 Query: 202 CCDFNSFSTTQVGDRCF 252 CC + ST +V ++C+ Sbjct: 41 CCRYEPISTEEVAEKCY 57 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 455 ITSTRSSKVLPSKRAVWHAWPWPLILTSS 541 +++ + SK+ + A + WPW + L SS Sbjct: 195 LSTKQLSKIAGGRPADSNEWPWMVALVSS 223 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.0 bits (47), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 471 ERVEVITYASQNLRDCSC 418 E ++ TYA +NL C C Sbjct: 19 ECIDTTTYAKKNLNYCCC 36 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -2 Query: 601 SSRAIDGMIMLSTR*TLNLTRAREYEWPRPSVPHCT 494 S+R+ G+++L+ ++ + Y P P+ +CT Sbjct: 3 SNRSAFGLLLLAWLASVTILGVEAYATPPPTTANCT 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,023 Number of Sequences: 2352 Number of extensions: 16593 Number of successful extensions: 29 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -