BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30234 (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42179| Best HMM Match : rve (HMM E-Value=9.8e-05) 28 7.2 SB_8851| Best HMM Match : rve (HMM E-Value=6.2e-17) 28 7.2 SB_56069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_45248| Best HMM Match : rve (HMM E-Value=2.1e-05) 28 7.2 SB_34781| Best HMM Match : rve (HMM E-Value=3.4e-19) 28 7.2 SB_28193| Best HMM Match : rve (HMM E-Value=2.1e-05) 28 7.2 SB_55741| Best HMM Match : rve (HMM E-Value=5.4e-18) 28 9.5 SB_53661| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=1.2) 28 9.5 SB_52693| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_30087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_2771| Best HMM Match : rve (HMM E-Value=0.00087) 28 9.5 SB_48292| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_27019| Best HMM Match : rve (HMM E-Value=6.6e-15) 28 9.5 SB_21217| Best HMM Match : rve (HMM E-Value=5.4e-18) 28 9.5 SB_17224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_14513| Best HMM Match : rve (HMM E-Value=0.14) 28 9.5 >SB_42179| Best HMM Match : rve (HMM E-Value=9.8e-05) Length = 211 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL Q LF+ QY K+ Sbjct: 187 FHRWLAQCLFRAQYSKE 203 >SB_8851| Best HMM Match : rve (HMM E-Value=6.2e-17) Length = 469 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL Q LF+ QY K+ Sbjct: 389 FHRWLAQCLFRAQYSKE 405 >SB_56069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH+WL Q LF+ QY K+ Sbjct: 114 FHSWLAQRLFRAQYSKE 130 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL+Q LF+ QY K+ Sbjct: 233 FHRWLVQRLFRAQYSKE 249 >SB_45248| Best HMM Match : rve (HMM E-Value=2.1e-05) Length = 809 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQS*S-YTVFVLCPTEQQLSS 608 FH WL Q LF+ QY K+ S T C T + LS+ Sbjct: 765 FHRWLAQRLFRAQYSKELASGKTNSQCCITRRTLST 800 >SB_34781| Best HMM Match : rve (HMM E-Value=3.4e-19) Length = 315 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL+Q LF+ QY K+ Sbjct: 178 FHRWLVQRLFRAQYSKE 194 >SB_28193| Best HMM Match : rve (HMM E-Value=2.1e-05) Length = 983 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQS*S-YTVFVLCPTEQQLSS 608 FH WL Q LF+ QY K+ S T C T + LS+ Sbjct: 939 FHRWLAQRLFRAQYSKELASGKTNSQCCITRRTLST 974 >SB_55741| Best HMM Match : rve (HMM E-Value=5.4e-18) Length = 325 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 492 LLQ*FHTWLLQILFKHQYKKQ 554 L + FH WL Q LF+ QY K+ Sbjct: 180 LAESFHRWLAQRLFRAQYSKE 200 >SB_53661| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=1.2) Length = 256 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 115 ICTLRFLQAFSEVIG*LIERFYCLQLRRQF 204 IC LR L+A+ E L+ + Y L RR+F Sbjct: 163 ICMLRLLEAYLESAPQLVLQLYILSYRRRF 192 >SB_52693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQS*SYT 569 FH WL Q LF+ QY K+ S T Sbjct: 113 FHRWLAQRLFRAQYSKELASET 134 >SB_30087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 486 KMLLQ*FHTWLLQILFKHQYKKQ 554 K + FH WL Q LF+ QY K+ Sbjct: 6 KAFAESFHRWLAQRLFRAQYSKE 28 >SB_2771| Best HMM Match : rve (HMM E-Value=0.00087) Length = 809 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL+Q LF+ QY K+ Sbjct: 706 FHRWLVQRLFRAQYPKE 722 >SB_48292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL Q LF+ QY K+ Sbjct: 113 FHRWLAQSLFRAQYSKE 129 >SB_46598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1910 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 486 KMLLQ*FHTWLLQILFKHQYKKQ 554 K + FH WL Q LF+ QY K+ Sbjct: 1838 KAFAESFHRWLAQRLFRAQYSKE 1860 >SB_27019| Best HMM Match : rve (HMM E-Value=6.6e-15) Length = 684 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 486 KMLLQ*FHTWLLQILFKHQYKKQ 554 K + FH WL Q LF+ QY K+ Sbjct: 539 KAFAESFHRWLAQRLFRAQYSKE 561 >SB_21217| Best HMM Match : rve (HMM E-Value=5.4e-18) Length = 325 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 492 LLQ*FHTWLLQILFKHQYKKQ 554 L + FH WL Q LF+ QY K+ Sbjct: 180 LAESFHRWLAQRLFRAQYSKE 200 >SB_17224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 935 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 498 Q*FHTWLLQILFKHQYKKQ 554 Q FH WL Q LF+ QY K+ Sbjct: 721 QSFHRWLAQRLFRAQYSKE 739 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 498 Q*FHTWLLQILFKHQYKKQ 554 Q FH WL Q LF+ QY K+ Sbjct: 777 QSFHRWLAQRLFRAQYSKE 795 >SB_14513| Best HMM Match : rve (HMM E-Value=0.14) Length = 1101 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 504 FHTWLLQILFKHQYKKQ 554 FH WL Q LF+ QY K+ Sbjct: 999 FHRWLAQSLFRAQYSKE 1015 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,129,307 Number of Sequences: 59808 Number of extensions: 334878 Number of successful extensions: 809 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -