BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30234 (762 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27785.1 68416.m03466 myb family transcription factor (MYB118... 29 2.6 At1g73740.1 68414.m08538 glycosyl transferase family 28 protein ... 28 5.9 >At3g27785.1 68416.m03466 myb family transcription factor (MYB118) contains PFAM profile: PF00249 myb-like DNA binding domain Length = 437 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 177 LLSAAKKTVLNRMQNVYVLLHNMIIKAAKIKTKHSRF 287 LLSA + T++NR QN + ++IK +IK K+ RF Sbjct: 142 LLSANEDTIMNRRQN-----NQVMIKTEQIKKKNKRF 173 >At1g73740.1 68414.m08538 glycosyl transferase family 28 protein similar to UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)- pyrophosphoryl-undecaprenol N-acetylglucosamine transferase GB:O07670 [SP|O07670] from Enterococcus hirae, ]SP|O07109] from Enterococcus faecalis; contains Pfam profile PF04101: Glycosyltransferase family 28 C-terminal domain Length = 431 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = +1 Query: 529 FSSISTRNNHEAIPFLCYVQ-LNNSLAVREVTYVQ*CLIRSLKISIL-----HALFEIRY 690 FS+IST + + PFLC+ L L + + T+ ++R LK I+ HA F + + Sbjct: 106 FSTISTVGSSSSRPFLCFTSFLKFPLRLIQSTFESYKILRELKPQIVIGTGGHASFPVCF 165 Query: 691 A 693 A Sbjct: 166 A 166 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,251,674 Number of Sequences: 28952 Number of extensions: 230514 Number of successful extensions: 359 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -