BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30232X (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54877| Best HMM Match : NAD_binding_4 (HMM E-Value=0) 62 2e-10 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_2969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 >SB_54877| Best HMM Match : NAD_binding_4 (HMM E-Value=0) Length = 373 Score = 62.5 bits (145), Expect = 2e-10 Identities = 30/70 (42%), Positives = 46/70 (65%) Frame = +3 Query: 255 QRLEEFPKNLVFEKLLDTNTTDIFKKLVPISGDVGEANLGLSPQDRQLLIENVNVVIHSA 434 QR++ + +F+ + + N D K+ I+GD+ EA+LGLSP+D L+I +V +V HSA Sbjct: 54 QRIDNMLQTRLFQNVRE-NDPDQLDKVTAITGDIAEADLGLSPEDMALIIGSVQIVFHSA 112 Query: 435 ATLDFQENLR 464 AT+ F E LR Sbjct: 113 ATVRFDEELR 122 Score = 44.8 bits (101), Expect = 4e-05 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = +1 Query: 106 VRAFYSGKNFFITGGTGFVGLCLIEKILRGIPDVGKVYLLMRPK 237 ++ F++ K ITGGTGF+G L+EK+LR V +YLL R + Sbjct: 4 IQTFFADKVVLITGGTGFLGKVLLEKLLRSCRTVKCIYLLTRSR 47 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 10 NNKSCFIIIIVNHSYISQDTPEGRNKMTEESLVRAFYSGK 129 + ++CF++++V H + +P R S V A Y+ K Sbjct: 426 DKRACFLVLVVQHEIQRESSPVHRKPRKHASNVNAVYANK 465 >SB_2969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 3.7 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 294 KLLDTNTTDIFKKLVPISGD-VGEANLGLSPQDRQLLIENVNV 419 KLL+TN+ D+ +++VP+ D V + QDR+ + E+ V Sbjct: 68 KLLETNSADVNRRVVPLLRDAVHQLGENCLKQDRKSVTEDHEV 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,370,920 Number of Sequences: 59808 Number of extensions: 263892 Number of successful extensions: 529 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -