BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30231 (602 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 76 2e-14 04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379... 75 4e-14 02_02_0470 - 10700092-10700505 30 1.6 10_08_0951 - 21769342-21769752 29 3.7 02_04_0618 - 24428987-24429331,24429946-24430387,24433358-24433434 28 5.0 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 76.2 bits (179), Expect = 2e-14 Identities = 48/124 (38%), Positives = 66/124 (53%), Gaps = 5/124 (4%) Frame = +1 Query: 238 KNGGTRQYPSNVGKSFYPTQEKIRASSGGRPFSKHVRRIRPN-----LKIGTVCILLAGR 402 KNGGT +P GK + K + +P + R+ P + GTV ILLAGR Sbjct: 31 KNGGT--FPK-AGKPAAAAEPKFYPADDVKPRAPSTRKANPTKLRSTITPGTVLILLAGR 87 Query: 403 HAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQPM*SAPPPEFSLGNFKLPKHFNDDY 582 + GKRVV + L SGLLL+TGPF N P+RR+ Q A + + K+ K F+D Y Sbjct: 88 YMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQAYVIATSTKVDISGVKVDK-FDDKY 146 Query: 583 FKKN 594 F ++ Sbjct: 147 FARD 150 >04_04_0211 - 23636377-23636532,23636624-23636805,23637853-23637959, 23637997-23638280 Length = 242 Score = 74.9 bits (176), Expect = 4e-14 Identities = 44/104 (42%), Positives = 61/104 (58%), Gaps = 2/104 (1%) Frame = +1 Query: 289 PTQEKIRASSGGRPFS--KHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVT 462 PT+ + +SS FS + + +R ++ GTV ILLAGR GKRVV + L SGLLLVT Sbjct: 71 PTKLRSPSSSNLPEFSLFRFILLMRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVT 130 Query: 463 GPFAFNSCPLRRIPQPM*SAPPPEFSLGNFKLPKHFNDDYFKKN 594 GPF N P+RR+ QP A + + + K F+D YF ++ Sbjct: 131 GPFKINGVPIRRVNQPYVIATSTKVDISGVNVEK-FDDKYFSRD 173 >02_02_0470 - 10700092-10700505 Length = 137 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 364 LKIGTVCILLAGRHAGKRVVLVGILPSG 447 LK G ILL GR+AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRYAGRKAVIVRVFEEG 32 >10_08_0951 - 21769342-21769752 Length = 136 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 364 LKIGTVCILLAGRHAGKRVVLVGILPSG 447 LK G ILL GR AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRFAGRKAVIVRVFEEG 32 >02_04_0618 - 24428987-24429331,24429946-24430387,24433358-24433434 Length = 287 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 240 EWGNQTVPLKRREVLLPHSGENPCFIWWPSIQ 335 +WGN+ +KR S N CF +WP+++ Sbjct: 208 DWGNKAGEIKRFAPSAAQS-TNQCFTFWPNVE 238 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,733,481 Number of Sequences: 37544 Number of extensions: 376051 Number of successful extensions: 942 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 941 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -