BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30231 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 37 0.014 SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) 30 1.3 SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 36.7 bits (81), Expect = 0.014 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +1 Query: 466 PFAFNSCPLRRIPQPM*SAPPPEFSLGNFKLPKH-FNDD-YFK 588 PF N PLRRIPQ A + + KLP+H F D+ YFK Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEHAFADESYFK 44 >SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) Length = 561 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 275 PTFEGYCLVPPFFSPP 228 PT +GY LVP FFSPP Sbjct: 529 PTAQGYGLVPNFFSPP 544 >SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +3 Query: 357 TQPEDRNCLHSPRW*TCRQEGCTCWN-SAQRSAFSYWTFCFQFVPATPYS 503 TQ R HSPR CR CT +N + S+ T C + P +S Sbjct: 84 TQEAYRKNSHSPRKRQCRNRLCTSYNWIRNKETSSFVTLCHREKPVGHFS 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,236,521 Number of Sequences: 59808 Number of extensions: 388080 Number of successful extensions: 1264 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1255 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -