BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D57122 Cluster: PREDICTED: similar to trinucleot... 44 0.005 UniRef50_UPI0000DB762C Cluster: PREDICTED: similar to flavin ade... 41 0.027 UniRef50_Q98S30 Cluster: Putative uncharacterized protein kin; n... 37 0.44 UniRef50_O15405 Cluster: TOX high mobility group box family memb... 36 0.77 UniRef50_UPI00015B4280 Cluster: PREDICTED: similar to ENSANGP000... 36 1.0 UniRef50_Q6CAM0 Cluster: Tr|Q9Y7W9 Mycelial growth factor-1; n=2... 36 1.0 UniRef50_Q1JTB2 Cluster: Putative uncharacterized protein precur... 35 2.4 UniRef50_Q9NQ87 Cluster: Hairy/enhancer-of-split related with YR... 34 3.1 UniRef50_P35190 Cluster: PHO85 cyclin CLG1; n=2; Saccharomyces c... 33 5.5 UniRef50_P90245 Cluster: Genome polyprotein 1 [Contains: Protein... 33 7.2 UniRef50_Q8CJZ0 Cluster: Putative membrane protein; n=2; Strepto... 33 9.5 UniRef50_Q11AX3 Cluster: Cytochrome c, class I; n=3; Rhizobiales... 33 9.5 >UniRef50_UPI0000D57122 Cluster: PREDICTED: similar to trinucleotide repeat containing 9; n=1; Tribolium castaneum|Rep: PREDICTED: similar to trinucleotide repeat containing 9 - Tribolium castaneum Length = 554 Score = 43.6 bits (98), Expect = 0.005 Identities = 20/37 (54%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +1 Query: 403 RPENLEVPLSATR-DAKNSVYAMNDQTFHTPSFGDED 510 R EN+++ LS + + +++ Y M DQTFHTPSFGDED Sbjct: 44 RSENVDLSLSIPQSNFQSNGYDMGDQTFHTPSFGDED 80 >UniRef50_UPI0000DB762C Cluster: PREDICTED: similar to flavin adenine dinucleotide synthetase isoform 1; n=1; Apis mellifera|Rep: PREDICTED: similar to flavin adenine dinucleotide synthetase isoform 1 - Apis mellifera Length = 621 Score = 41.1 bits (92), Expect = 0.027 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Frame = +1 Query: 400 KRPENLEVPLSATRDAKNSV------YAMNDQTFHTPSFGDED 510 KR E+L+ L+ + +S YAM DQTFHTPSFGDED Sbjct: 183 KRNESLDFSLNVPQHHHHSTQYHQSSYAMADQTFHTPSFGDED 225 >UniRef50_Q98S30 Cluster: Putative uncharacterized protein kin; n=1; Guillardia theta|Rep: Putative uncharacterized protein kin - Guillardia theta (Cryptomonas phi) Length = 536 Score = 37.1 bits (82), Expect = 0.44 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = -1 Query: 379 MIYHDFRKPFVDTPFRFVHRTRKIMTVHLQHQVLIFLKGYFDPAVAAHKYLAIDFSQKVH 200 +I+H K ++ RFV K+ + + F K YF + + + I+F +K + Sbjct: 198 LIFHRILKNSINFTKRFVIYLEKLKFFSFFYHEIFFCKSYFRNSFGHSRIICIEFMKKSN 257 Query: 199 FVVYYDNVIIRS-SYQRLSMKFKQKSG 122 FV Y D ++I Y ++ + K SG Sbjct: 258 FVSYSDLLLINGVIYIKICLIAKGGSG 284 >UniRef50_O15405 Cluster: TOX high mobility group box family member 3; n=34; Coelomata|Rep: TOX high mobility group box family member 3 - Homo sapiens (Human) Length = 576 Score = 36.3 bits (80), Expect = 0.77 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +1 Query: 442 DAKNSVYAMNDQTFHTPSFGDED 510 +A N+ +A ++QTFHTPS GDE+ Sbjct: 41 EANNAFFAASEQTFHTPSLGDEE 63 >UniRef50_UPI00015B4280 Cluster: PREDICTED: similar to ENSANGP00000012345; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000012345 - Nasonia vitripennis Length = 706 Score = 35.9 bits (79), Expect = 1.0 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 460 YAMNDQTFHTPSFGDED 510 Y M +QTFHTPSFGDED Sbjct: 176 YNMAEQTFHTPSFGDED 192 >UniRef50_Q6CAM0 Cluster: Tr|Q9Y7W9 Mycelial growth factor-1; n=2; Yarrowia lipolytica|Rep: Tr|Q9Y7W9 Mycelial growth factor-1 - Yarrowia lipolytica (Candida lipolytica) Length = 590 Score = 35.9 bits (79), Expect = 1.0 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 4/33 (12%) Frame = +2 Query: 644 PGGAPS---YQQPLY-LQEPHTPVTTHSGASAP 730 PGGA + YQQP+Y +PH P ++ SG SAP Sbjct: 189 PGGANTHLMYQQPMYGYSQPHVPASSQSGGSAP 221 >UniRef50_Q1JTB2 Cluster: Putative uncharacterized protein precursor; n=1; Toxoplasma gondii RH|Rep: Putative uncharacterized protein precursor - Toxoplasma gondii RH Length = 1453 Score = 34.7 bits (76), Expect = 2.4 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 385 LYNMYKRPENLEVPLSAT---RDAKNSVYAMNDQTFHTPSFGDEDLIFL 522 L + + PEN+E +A A NS+Y ND + FG E+L+FL Sbjct: 911 LKRLQENPENVETSRAACDFLSHASNSIYVTNDSRYLLNKFGPENLLFL 959 >UniRef50_Q9NQ87 Cluster: Hairy/enhancer-of-split related with YRPW motif-like protein; n=13; Amniota|Rep: Hairy/enhancer-of-split related with YRPW motif-like protein - Homo sapiens (Human) Length = 328 Score = 34.3 bits (75), Expect = 3.1 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +2 Query: 545 GIRSPEYAYSVHTITPRCAAVGMMNPAQDGLAPPGGAPSYQQPLYLQEPHTPV 703 G+ SP Y P A G++ PA+ + P GA S ++ L+ P TPV Sbjct: 206 GVSSPAYPIPALRTAPLRRATGIILPARRNVLPSRGASSTRRARPLERPATPV 258 >UniRef50_P35190 Cluster: PHO85 cyclin CLG1; n=2; Saccharomyces cerevisiae|Rep: PHO85 cyclin CLG1 - Saccharomyces cerevisiae (Baker's yeast) Length = 452 Score = 33.5 bits (73), Expect = 5.5 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 572 SVHTITPRCAAVGMMN-PAQDGLAPPGGAPSYQQPLYLQEPHTPVTTHSGAS 724 SVHT P A++G N P+ APP +QQP L P T+++ ++ Sbjct: 50 SVHTQLPSMASLGYFNQPSSTYYAPPAPLQQHQQPPILPPPGLMYTSNNNSN 101 >UniRef50_P90245 Cluster: Genome polyprotein 1 [Contains: Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (CI); 6 kDa protein 2 (6K2); Viral genome-linked protein (VPg); Nuclear inclusion protein A (EC 3.4.22.44) (NI-a) (NIa) (NIa-pro); Nuclear inclusion protein B (EC 2.7.7.48) (NI-b) (NIb) (RNA-directed RNA polymerase); Coat protein (CP)]; n=40; root|Rep: Genome polyprotein 1 [Contains: Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (CI); 6 kDa protein 2 (6K2); Viral genome-linked protein (VPg); Nuclear inclusion protein A (EC 3.4.22.44) (NI-a) (NIa) (NIa-pro); Nuclear inclusion protein B (EC 2.7.7.48) (NI-b) (NIb) (RNA-directed RNA polymerase); Coat protein (CP)] - Barley mild mosaic virus (strain Na1) (BaMMV) Length = 2258 Score = 33.1 bits (72), Expect = 7.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 607 YCGAAWCNCVY*ICVFWTP 551 Y G WCNC++ +C W+P Sbjct: 209 YWGEFWCNCIWLLCSLWSP 227 >UniRef50_Q8CJZ0 Cluster: Putative membrane protein; n=2; Streptomyces|Rep: Putative membrane protein - Streptomyces coelicolor Length = 335 Score = 32.7 bits (71), Expect = 9.5 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 557 PEYAYSVHTITPRCAAVGMMNPAQDGLAPPGGAPSYQQPLYLQEP 691 P Y Y T P+ G Q G PP P QQP Y Q+P Sbjct: 35 PGYGYPQQTPPPQQPGYGYPQQPQQGGVPPQAPPYGQQPGYGQQP 79 >UniRef50_Q11AX3 Cluster: Cytochrome c, class I; n=3; Rhizobiales|Rep: Cytochrome c, class I - Mesorhizobium sp. (strain BNC1) Length = 286 Score = 32.7 bits (71), Expect = 9.5 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 602 AVGMMNPAQDGLAPPGGAPS--YQQPLYLQEPHTPVTTHSGA 721 A G PAQDG AP GAP+ Q P +E TP T A Sbjct: 232 AEGTAAPAQDGAAPAEGAPAGDTQAPAQTEETTTPPATEGEA 273 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,387,598 Number of Sequences: 1657284 Number of extensions: 16067045 Number of successful extensions: 48352 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 45922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48317 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59265488880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -