BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.63 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.83 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 3.4 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.4 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 5.9 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 25.0 bits (52), Expect = 0.63 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 383 SCTICTRDLKISKCPCPLLATPRTVC 460 SCT+CT D K + C + + C Sbjct: 773 SCTVCTCDAKYLEIKCKRIYNEKQCC 798 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.83 Identities = 23/78 (29%), Positives = 33/78 (42%) Frame = +1 Query: 400 KRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFGDEDLIFL*YTGSMRRDQESRIRIFST 579 KRP E P+ + + Y + QT +TP +DL+ Y R D ES+ + Sbjct: 88 KRPPPDE-PIDDYEPSFDLFYYPSRQTLYTPVQYFKDLVAEAYVSPFRIDNESQELL--- 143 Query: 580 HNYTTLRRSRHDESSTGR 633 Y + R R S GR Sbjct: 144 -KYPSFARGRSLYDSRGR 160 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.5 Identities = 15/73 (20%), Positives = 30/73 (41%) Frame = +1 Query: 337 MECPQTASENHDRSYKLYNMYKRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFGDEDLI 516 +E + +E+ D K Y + + + L D++N +HT + GDE Sbjct: 410 LELFEELAEDKDGYKKFYEQFSK----NIKLGIHEDSQNRAKLSELLRYHTSASGDEACS 465 Query: 517 FL*YTGSMRRDQE 555 Y ++ +Q+ Sbjct: 466 LKDYVSRIKPNQK 478 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 17 APGHGLQPTMGDYTQL 32 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 540 APGSGVQNTHIQYTQL 587 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 621 GFIMPTAAQRGVIVCTEYA 565 GF+ PT A+RG I A Sbjct: 330 GFVHPTVAKRGSITSKNVA 348 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,775 Number of Sequences: 336 Number of extensions: 4105 Number of successful extensions: 19 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -