BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC649.04 |uvi15||UV-induced protein Uvi15|Schizosaccharomyces ... 29 0.90 SPCC970.10c |brl2|rfp1|ubiquitin-protein ligase E3 Brl2|Schizosa... 28 1.6 SPCC63.07 |||tRNA guanylyltransferase |Schizosaccharomyces pombe... 28 1.6 SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21... 27 3.6 SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomy... 26 4.8 SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ... 26 4.8 SPAC20G4.03c |hri1||eIF2 alpha kinase Hri1|Schizosaccharomyces p... 26 6.4 SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pomb... 26 6.4 >SPBC649.04 |uvi15||UV-induced protein Uvi15|Schizosaccharomyces pombe|chr 2|||Manual Length = 87 Score = 28.7 bits (61), Expect = 0.90 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 4/29 (13%) Frame = +2 Query: 617 NPAQDGLAPPGGAPS----YQQPLYLQEP 691 N Q G APP G P QQP+Y+Q+P Sbjct: 32 NYPQQGYAPPQGYPQGGYPAQQPMYVQQP 60 >SPCC970.10c |brl2|rfp1|ubiquitin-protein ligase E3 Brl2|Schizosaccharomyces pombe|chr 3|||Manual Length = 680 Score = 27.9 bits (59), Expect = 1.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 350 CGHSIPIRAQNSKNYDGPFTAS 285 C H I + +Q SKN++G F +S Sbjct: 317 CSHEINVLSQQSKNFNGVFESS 338 >SPCC63.07 |||tRNA guanylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 261 Score = 27.9 bits (59), Expect = 1.6 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 435 YSRRQEQCVRHE*SDISHSFI--W*RRFDIPLI 527 Y RR+ + V H S + +F+ W + FDIPL+ Sbjct: 89 YERRESKLVSHVCSLFTSAFVFNWPKHFDIPLL 121 >SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 20 FPAGAPSRFRNYTPACRARVPATCSP 97 FPA +P R TP AR P SP Sbjct: 34 FPASSPGSTRLTTPRTTARTPLASSP 59 >SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 26.2 bits (55), Expect = 4.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 600 AQRGVIVCTEYAYSGLLIPA 541 A++G+++CT A GL IPA Sbjct: 385 AEKGILLCTNVAARGLDIPA 404 >SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 791 Score = 26.2 bits (55), Expect = 4.8 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 516 IPLIHGQHAPGSGVQNTH 569 +P ++GQ+AP +G+ N H Sbjct: 688 VPPMYGQYAPNNGMMNMH 705 >SPAC20G4.03c |hri1||eIF2 alpha kinase Hri1|Schizosaccharomyces pombe|chr 1|||Manual Length = 704 Score = 25.8 bits (54), Expect = 6.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 385 LYNMYKRPENLEVPLSATRDAKNSVYAMND 474 L+N+ + +P+S+T+D+K S Y+ D Sbjct: 104 LHNLLSKAFRSTLPMSSTKDSKKSRYSSPD 133 >SPBC106.17c |cys2||O-acetyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.8 bits (54), Expect = 6.4 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +3 Query: 6 PIHLGFRRVLPRGSATIPQRAEPACRPRALRNPLDTGGTPLFCLNFI 146 P H G + L R ATI R+ P R D +P FC +F+ Sbjct: 281 PPHTGMK--LAREVATISYRSGPEWEQRFGNRRADPSVSPAFCPDFL 325 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,100,032 Number of Sequences: 5004 Number of extensions: 63610 Number of successful extensions: 195 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -