BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_39648| Best HMM Match : DUF1110 (HMM E-Value=1.7) 28 6.8 SB_34049| Best HMM Match : PSI (HMM E-Value=2.6) 28 6.8 SB_47915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 28 9.0 >SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.3 bits (70), Expect = 0.42 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 328 RIGMECPQTASENHDRSYKLYNMYKRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFGDE 507 R+GM Q E H ++ + ++K E + VP+ ++ K MND + + GD+ Sbjct: 24 RMGMTECQNTDEVHKKTTHRHGLWKHDEMITVPMMISQMMK---VVMNDDDYKEDNLGDD 80 Query: 508 D 510 D Sbjct: 81 D 81 >SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 31.1 bits (67), Expect = 0.96 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -2 Query: 633 PSCAGFIMPTAAQRGVIVCTEYAYSGLLIPAHAARVLKEYQIFVTK 496 P C + P A+ G+ C++Y G +++ + YQ VTK Sbjct: 22 PQCLDYRPPFKAREGLAFCSQYNAFGCCTRGQDSKISRRYQNLVTK 67 >SB_39648| Best HMM Match : DUF1110 (HMM E-Value=1.7) Length = 472 Score = 28.3 bits (60), Expect = 6.8 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 5/75 (6%) Frame = -1 Query: 583 CVY*ICVFWTPDPGACCPCIKGISNL-RHQMK---ECEMS-DHSWRTHCSWRRE*RTGAL 419 CV I V W C C+ IS + R +++ EC +S WR + E Sbjct: 131 CVVSIAVVWRVRVRFCVECVVSISRVWRVRVRFCVECVVSISRVWRVRVRFCVECVVSIS 190 Query: 418 RDFQVSCTYCTACMI 374 R ++V +C C++ Sbjct: 191 RKWRVRVRFCVECVV 205 >SB_34049| Best HMM Match : PSI (HMM E-Value=2.6) Length = 279 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -1 Query: 538 CCPCIKGISNLRHQMKECEMSDHSWRTHCSWRRE*RTGALRDFQVSC 398 CC IKG+ +LR+ DH W + S R +LRD++ C Sbjct: 229 CCVTIKGLCSLRNDEWLSSFRDHEWLS--SLRDYEWLCSLRDYEWLC 273 >SB_47915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 580 HNYTTLRRSRHDESSTGRLGPTRWC 654 H Y ++RR R++ S P RWC Sbjct: 36 HGYESIRRQRYELISRHGYEPNRWC 60 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +1 Query: 334 GMECPQTASENHDRSYKLYNMYKRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFG 501 G +CP T+ D M++ E+ A + ++N+ ++ N Q+F TP G Sbjct: 784 GDDCPSTSQREDDNPVS--KMFQE----EIRARARKYSQNTGFSQNQQSFSTPEHG 833 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,773,952 Number of Sequences: 59808 Number of extensions: 527561 Number of successful extensions: 1659 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1651 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -