BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 29 0.11 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.4 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 29.5 bits (63), Expect = 0.11 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 638 APPGGAPSYQQPLYLQEPHTPVTTHSGASAPA 733 +P GG+P + P + P TP +G S+PA Sbjct: 1103 SPMGGSPRPETPAFPVTPRTPYGLSNGTSSPA 1134 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.4 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = -1 Query: 403 SCTYCTACMIYHDFRKPFVDTPFRFVHRTRKIMTVHLQHQVLIFLKGYFDPAVAAHKYLA 224 +C CT C ++P D P + V + R + + I +KG AV Y++ Sbjct: 1392 NCVKCTRCRPKL-IQQPMADLPEQRVRQARPFSISGVDYAGPIMVKGTHRRAVPTKGYIS 1450 Query: 223 I 221 I Sbjct: 1451 I 1451 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 507 RFDIPLIHGQHAPGSGVQNTHIQYTQLHHAAPQ 605 R + L H QH PG+GVQ +Q H Q Sbjct: 225 RMEYLLPHQQHPPGAGVQGAGPIPSQQKHQQHQ 257 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 837,231 Number of Sequences: 2352 Number of extensions: 19919 Number of successful extensions: 49 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -