BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21309-6|AAT92086.1| 541|Caenorhabditis elegans Hypothetical pr... 32 0.48 U21309-4|AAN73883.1| 546|Caenorhabditis elegans Hypothetical pr... 32 0.48 AY314778-1|AAQ84885.1| 546|Caenorhabditis elegans calcitonin re... 32 0.48 AY314777-1|AAQ84884.1| 541|Caenorhabditis elegans calcitonin re... 32 0.48 U21309-5|AAT92085.1| 536|Caenorhabditis elegans Hypothetical pr... 31 0.84 AY314776-1|AAQ84883.1| 536|Caenorhabditis elegans calcitonin re... 31 0.84 Z82059-4|CAB04877.1| 314|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z78540-6|CAD30431.1| 887|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z78540-5|CAB01738.2| 793|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z72501-3|CAD30430.1| 887|Caenorhabditis elegans Hypothetical pr... 28 7.8 AJ133838-1|CAB44432.1| 793|Caenorhabditis elegans DYC-1 protein... 28 7.8 >U21309-6|AAT92086.1| 541|Caenorhabditis elegans Hypothetical protein C13B9.4c protein. Length = 541 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = -1 Query: 592 WCNCVY*ICVFWTPDPGAC-----CPCIKGISNLRHQMKECEMS 476 WCN Y + W P P CP +KG+ ++ K+C +S Sbjct: 73 WCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVS 116 >U21309-4|AAN73883.1| 546|Caenorhabditis elegans Hypothetical protein C13B9.4a protein. Length = 546 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = -1 Query: 592 WCNCVY*ICVFWTPDPGAC-----CPCIKGISNLRHQMKECEMS 476 WCN Y + W P P CP +KG+ ++ K+C +S Sbjct: 73 WCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVS 116 >AY314778-1|AAQ84885.1| 546|Caenorhabditis elegans calcitonin receptor-like proteinSEB-1C protein. Length = 546 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = -1 Query: 592 WCNCVY*ICVFWTPDPGAC-----CPCIKGISNLRHQMKECEMS 476 WCN Y + W P P CP +KG+ ++ K+C +S Sbjct: 73 WCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVS 116 >AY314777-1|AAQ84884.1| 541|Caenorhabditis elegans calcitonin receptor-like proteinSEB-1B protein. Length = 541 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = -1 Query: 592 WCNCVY*ICVFWTPDPGAC-----CPCIKGISNLRHQMKECEMS 476 WCN Y + W P P CP +KG+ ++ K+C +S Sbjct: 73 WCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVS 116 >U21309-5|AAT92085.1| 536|Caenorhabditis elegans Hypothetical protein C13B9.4b protein. Length = 536 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -1 Query: 592 WCNCVY*ICVFWTPDPGAC-----CPCIKGISNLRHQMKECE 482 WCN Y + W P P CP +KG+ ++ +K C+ Sbjct: 73 WCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCD 114 >AY314776-1|AAQ84883.1| 536|Caenorhabditis elegans calcitonin receptor-like proteinSEB-1A protein. Length = 536 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -1 Query: 592 WCNCVY*ICVFWTPDPGAC-----CPCIKGISNLRHQMKECE 482 WCN Y + W P P CP +KG+ ++ +K C+ Sbjct: 73 WCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCD 114 >Z82059-4|CAB04877.1| 314|Caenorhabditis elegans Hypothetical protein T27E9.8 protein. Length = 314 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -1 Query: 277 IFLKGYFDPAVAAHKYLAIDFSQKVHFVVYYDNVIIRSSYQ-RLSMKFK 134 ++L YF + HK +A D+SQ + ++ +N + +Q +S FK Sbjct: 132 LYLTSYFMEDIEFHKKIAKDYSQHFNELILENNFLESRKFQTAISSNFK 180 >Z78540-6|CAD30431.1| 887|Caenorhabditis elegans Hypothetical protein C33G3.1b protein. Length = 887 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 638 APPGGAPSYQQPLYLQEPHTPVTTHS 715 APP G P Y + L L +P P TT S Sbjct: 223 APPVGGPLYGKRLSLFQPRKPSTTSS 248 >Z78540-5|CAB01738.2| 793|Caenorhabditis elegans Hypothetical protein C33G3.1a protein. Length = 793 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 638 APPGGAPSYQQPLYLQEPHTPVTTHS 715 APP G P Y + L L +P P TT S Sbjct: 129 APPVGGPLYGKRLSLFQPRKPSTTSS 154 >Z72501-3|CAD30430.1| 887|Caenorhabditis elegans Hypothetical protein C33G3.1b protein. Length = 887 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 638 APPGGAPSYQQPLYLQEPHTPVTTHS 715 APP G P Y + L L +P P TT S Sbjct: 223 APPVGGPLYGKRLSLFQPRKPSTTSS 248 >AJ133838-1|CAB44432.1| 793|Caenorhabditis elegans DYC-1 protein protein. Length = 793 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 638 APPGGAPSYQQPLYLQEPHTPVTTHS 715 APP G P Y + L L +P P TT S Sbjct: 129 APPVGGPLYGKRLSLFQPRKPSTTSS 154 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,962,954 Number of Sequences: 27780 Number of extensions: 392490 Number of successful extensions: 1111 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1107 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -