BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.97 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 3.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.0 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 9.0 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.0 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.6 bits (51), Expect = 0.97 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 524 NTRAACAGIRSPEYAYSVHTITPRCAAVGMMNPA 625 N+RA P+ Y+V PRCA +P+ Sbjct: 132 NSRANTYNFDYPQVPYTVKNFHPRCAVNNYNDPS 165 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 662 KKEHHLVGPS 633 +KEHHL GPS Sbjct: 197 RKEHHLEGPS 206 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 91 LSAIRSTLAAPRFFA 135 L AIR+TL A FFA Sbjct: 461 LKAIRATLKASPFFA 475 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 91 LSAIRSTLAAPRFFA 135 L AIR+TL A FFA Sbjct: 376 LKAIRATLKASPFFA 390 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 91 LSAIRSTLAAPRFFA 135 L AIR+TL A FFA Sbjct: 695 LKAIRATLKASPFFA 709 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,412 Number of Sequences: 438 Number of extensions: 4921 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -