BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30229 (733 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16090.1 68417.m02439 hypothetical protein contains Pfam prof... 32 0.34 At4g22250.1 68417.m03219 zinc finger (C3HC4-type RING finger) fa... 30 1.8 At4g13100.2 68417.m02042 zinc finger (C3HC4-type RING finger) fa... 29 4.2 At4g13100.1 68417.m02041 zinc finger (C3HC4-type RING finger) fa... 29 4.2 At3g25030.1 68416.m03128 zinc finger (C3HC4-type RING finger) fa... 29 4.2 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 28 5.6 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 7.3 At1g62370.1 68414.m07037 zinc finger (C3HC4-type RING finger) fa... 27 9.7 >At4g16090.1 68417.m02439 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 251 Score = 32.3 bits (70), Expect = 0.34 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 412 NLEVPLSATRDAKNSVYAMNDQTFHTPSFGDEDLIF 519 N P +D+ + +Y+ D+ F+TPSFG L+F Sbjct: 165 NFNRPGGTHKDSGSVMYSKRDEKFYTPSFGGHFLVF 200 >At4g22250.1 68417.m03219 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 214 Score = 29.9 bits (64), Expect = 1.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 377 HTSCTICTRDLKISKCPCPLLATP 448 HT C +C+R+L +++ CPL P Sbjct: 183 HTFCRVCSRELWLNRGSCPLCNRP 206 >At4g13100.2 68417.m02042 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 265 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 377 HTSCTICTRDLKISKCPCPLLAT 445 HT C +C+R+L + + CPL T Sbjct: 234 HTFCRLCSRELWVQRGNCPLCNT 256 >At4g13100.1 68417.m02041 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 304 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 377 HTSCTICTRDLKISKCPCPLLAT 445 HT C +C+R+L + + CPL T Sbjct: 273 HTFCRLCSRELWVQRGNCPLCNT 295 >At3g25030.1 68416.m03128 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 250 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 377 HTSCTICTRDLKISKCPCPLLAT 445 HT C +C+R+L + + CPL T Sbjct: 219 HTFCRLCSRELWVQRGNCPLCNT 241 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 620 PAQDGLAPPGGAPSYQQPLYLQEPHTPVTTHS 715 P++ G+ PPGGAP + P + P P H+ Sbjct: 221 PSRPGMPPPGGAPMFAPP-HPGMPPAPPNHHN 251 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 590 PRCAAVGMMNPAQDGLAPPGGAPSYQQPLYLQEPHTPVT 706 P A + P G PPG PS + +Y+ HT VT Sbjct: 33 PGVLAPPQLEPVPSGNLPPGFDPSTCRSVYVGNIHTQVT 71 >At1g62370.1 68414.m07037 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 204 Score = 27.5 bits (58), Expect = 9.7 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +2 Query: 377 HTSCTICTRDLKISKCPCPL 436 HT C +C+R++ +++ CPL Sbjct: 173 HTYCRVCSREIWMNRGTCPL 192 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,562,469 Number of Sequences: 28952 Number of extensions: 347057 Number of successful extensions: 972 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -