BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30228 (712 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 35 2.3 UniRef50_A7EEP1 Cluster: Putative uncharacterized protein; n=1; ... 34 3.0 UniRef50_Q9PQJ8 Cluster: Unique hypothetical; n=1; Ureaplasma pa... 34 4.0 UniRef50_A2EZD8 Cluster: Putative uncharacterized protein; n=3; ... 33 6.9 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 34.7 bits (76), Expect = 2.3 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 208 WYLPARTHNRSYHQ 249 WYLPARTH RSYH+ Sbjct: 572 WYLPARTHKRSYHR 585 >UniRef50_A7EEP1 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 574 Score = 34.3 bits (75), Expect = 3.0 Identities = 19/38 (50%), Positives = 22/38 (57%) Frame = +2 Query: 140 LQRPPHPSNRNALLLHGRNRQGGGTYPRVLTTGPTTSN 253 +Q PPHP N NA R RQGG T P L + TTS+ Sbjct: 136 IQSPPHPHN-NAASNSPRFRQGGSTQPEPLLSLLTTSH 172 >UniRef50_Q9PQJ8 Cluster: Unique hypothetical; n=1; Ureaplasma parvum|Rep: Unique hypothetical - Ureaplasma parvum (Ureaplasma urealyticum biotype 1) Length = 1447 Score = 33.9 bits (74), Expect = 4.0 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 1/83 (1%) Frame = +2 Query: 296 NLFEVITKSIPNLMKIGSMVWQRIEDKHTEH*SIYASLPVDVIKKTPHNEYSTKH-RDIC 472 N+F+ I K IPNL+ + ++V Q ++ +I A + +K T N++ K+ DI Sbjct: 270 NIFDKILKQIPNLLYLQNIVDQSVDFLKV---NIEALINHQPLKNTTWNDFINKNVTDIS 326 Query: 473 RLCRLKIRYQTSEFTAHSNSRVV 541 L L ++T+E T + ++++ Sbjct: 327 ALSNLLEIFETNEITNNEWNQLI 349 >UniRef50_A2EZD8 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 728 Score = 33.1 bits (72), Expect = 6.9 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Frame = +2 Query: 278 KYDIAYNLFEVITKSIP-NLMKIGSMVWQR---IEDKHTEH*SIYASLPVDVIKKTPHNE 445 K +++Y++F +P ++ G+ W+R + D +H + SL +D++ + E Sbjct: 420 KEEVSYDIFSEFNPQMPITILTNGAAAWERCVVLCDPQRKH-QVLKSL-IDLVIQANLRE 477 Query: 446 YSTKHRDICRLCRLK 490 Y + + CR+C +K Sbjct: 478 YLITYLEACRICMMK 492 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,459,005 Number of Sequences: 1657284 Number of extensions: 14424251 Number of successful extensions: 32067 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32056 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57024798702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -