BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30228 (712 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1601 - 28047764-28047845,28048043-28048078,28048209-280483... 28 6.4 06_03_0500 + 21470681-21470952,21471049-21471089,21472322-214724... 28 8.4 >07_03_1601 - 28047764-28047845,28048043-28048078,28048209-28048339, 28048695-28048967,28049039-28049166,28049250-28049369, 28049461-28049538,28049598-28049669,28049790-28049849, 28050096-28050217,28052918-28053048,28053382-28053534, 28053628-28053755,28053831-28053968,28054056-28054144, 28055741-28055878,28056870-28057102 Length = 703 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 272 IYKYDIAYNLFEVITKSIPNLMKI 343 +YKYD+ YN+ + TK P L I Sbjct: 257 LYKYDLQYNIAVIETKFFPGLRAI 280 >06_03_0500 + 21470681-21470952,21471049-21471089,21472322-21472485, 21472577-21472679,21472806-21472975,21473766-21474239 Length = 407 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 341 IGSMVWQRIEDKHTEH*SIYASLPVDVIKKTPHNE 445 +G + W+ E+ T+H Y ++ VI K H + Sbjct: 95 VGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTK 129 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,676,580 Number of Sequences: 37544 Number of extensions: 397967 Number of successful extensions: 812 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -