BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30228 (712 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 31 0.70 SB_58734| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_45300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 31.5 bits (68), Expect = 0.70 Identities = 22/83 (26%), Positives = 35/83 (42%) Frame = +2 Query: 206 GGTYPRVLTTGPTTSNSQVIIMIYKYDIAYNLFEVITKSIPNLMKIGSMVWQRIEDKHTE 385 G P+++T TT ++ + I LF + P + S+V+++I KH Sbjct: 698 GNDVPQIVTDKLTTGLFAQLVRVTL--IIAVLFTYPLQLFPVIQIAESLVFEKIRRKHKS 755 Query: 386 H*SIYASLPVDVIKKTPHNEYST 454 H S S P D I + Y T Sbjct: 756 HLSDIVSCPADAIGRQEVTNYQT 778 >SB_58734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 173 ALLLHGRNRQGGGTYPRVLTTGPTTSNSQVIIMIYKYDIAYNLFEVIT 316 +++LH R+R G T R S+ V+IM +D+AY +EV T Sbjct: 22 SVILHQRSRNGRPT-TRYFVLNLAISDLLVLIMFIPFDLAYLEYEVWT 68 >SB_45300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +1 Query: 418 CHKENPTQRV*YKTQRYLSSV*TQNPVPNFRIYSSFKFTSR 540 C KENP + Y Q Y S+ N R YSS K SR Sbjct: 82 CIKENPIDKDQYNDQYYSSTKQVSRHQYNDRYYSSTKQVSR 122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,955,450 Number of Sequences: 59808 Number of extensions: 467499 Number of successful extensions: 951 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -