BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30228 (712 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82058-1|CAB04862.2| 352|Caenorhabditis elegans Hypothetical pr... 31 1.1 U80847-4|AAB37986.1| 112|Caenorhabditis elegans Hypothetical pr... 29 4.3 Z81091-5|CAB03142.1| 768|Caenorhabditis elegans Hypothetical pr... 28 5.7 >Z82058-1|CAB04862.2| 352|Caenorhabditis elegans Hypothetical protein T27C5.1 protein. Length = 352 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -3 Query: 365 YVAIPLIQFSLNLV*ISLSLQISCMLYHIYI 273 Y+ IPLI F L++V L Q+ C++Y+IYI Sbjct: 209 YILIPLILFVLSVVGHYL-FQMGCLVYYIYI 238 >U80847-4|AAB37986.1| 112|Caenorhabditis elegans Hypothetical protein C17H11.5 protein. Length = 112 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 416 PREEMHKWINVPYVCPLYVAIPLIQFSL 333 PR +++ W+ VP VCP +I+FS+ Sbjct: 11 PRNKLNDWVGVPPVCPENDDGAIIEFSV 38 >Z81091-5|CAB03142.1| 768|Caenorhabditis elegans Hypothetical protein F55H12.1 protein. Length = 768 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 43 SPPGIKWLIEPIVIYIVNAPPTLRYKL*ALSIVTTAAPP 159 +P K I P + APPT+R + ++ TT APP Sbjct: 3 TPVSTKKTIAPSTMKTTVAPPTMRTTMAPTTMKTTVAPP 41 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,291,122 Number of Sequences: 27780 Number of extensions: 359934 Number of successful extensions: 827 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -