BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30228 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 27 0.18 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.9 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 8.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 27.1 bits (57), Expect = 0.18 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 528 FE*AVNSEVWYRILSLHRRQISLCFVLYSLCGVF 427 FE + N++ W R+ SLH + C VL G F Sbjct: 79 FESSFNAQSWQRLTSLHELHVHGCKVLRIPEGAF 112 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 224 VLTTGPTTSNSQVIIMIYKYDIAYNLFEVITKSIPNLMKIGSMVWQRIEDK 376 ++ T P S Q + K D + + +I +LMK+ S W+ + K Sbjct: 707 LMKTNPPLSMLQRMAEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKK 757 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/53 (18%), Positives = 26/53 (49%) Frame = +3 Query: 435 HTTSIVQNTEIFVVCVDSKSGTKLQNLQLIQIHESYLQTNRN*LLSILDLDQY 593 HT + ++ + ++S S TKL + L+Q + ++ + ++ ++ Y Sbjct: 500 HTLDVAWRRKVTIEILNSLSATKLSKIILMQFGDKLESSHDSFQAALRSIENY 552 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/53 (18%), Positives = 26/53 (49%) Frame = +3 Query: 435 HTTSIVQNTEIFVVCVDSKSGTKLQNLQLIQIHESYLQTNRN*LLSILDLDQY 593 HT + ++ + ++S S TKL + L+Q + ++ + ++ ++ Y Sbjct: 538 HTLDVAWRRKVTIEILNSLSATKLSKIILMQFGDKLESSHDSFQAALRSIENY 590 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.4 bits (43), Expect = 8.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 456 FVLYSLCGVFFMTSTGRDA*MD*CSVCLSSIRCHTID 346 ++LYSL VF + G + SV ++ CH D Sbjct: 162 YLLYSLGQVFMLCIFGNRLIEESSSVMEAAYSCHWYD 198 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 643 NCMPNRFNRGLSR 605 +C PN +NRG+ R Sbjct: 72 SCGPNVYNRGVQR 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,366 Number of Sequences: 438 Number of extensions: 4593 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -