BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30226 (747 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35461| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 41 0.001 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 35 0.081 SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) 33 0.25 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 33 0.25 SB_50345| Best HMM Match : Cadherin (HMM E-Value=0) 32 0.57 SB_52466| Best HMM Match : Cation_ATPase_C (HMM E-Value=6.7e-12) 31 0.75 SB_23440| Best HMM Match : BAT2_N (HMM E-Value=7.5) 31 0.75 SB_10520| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_42099| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_3454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_22952| Best HMM Match : EGF_2 (HMM E-Value=2e-23) 29 4.0 SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) 29 4.0 SB_56837| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) 28 9.2 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_30923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_35461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 45.2 bits (102), Expect = 6e-05 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 569 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQS-ENSTEPYTDYFIW 721 T+++F+ L I G+++++D +PN+ H WF++S N P +++IW Sbjct: 97 TMEDFESLLQDIHSRGMKLLLDFVPNHTSDQHDWFLESRSNRHNPRREWYIW 148 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +2 Query: 515 VQGVFVQVPTYEVLDKRDTLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSE-NS 691 + VF + +V + +++F+ L K +RVIVD +PN+ + WF +S N Sbjct: 687 IGAVFSEEDLQDVNNALGKMEDFQNLLKKAHDRKMRVIVDFVPNHTSKKNKWFEESSVNK 746 Query: 692 TEPYTDYFIW 721 T ++++W Sbjct: 747 TNSKRNWYVW 756 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 34.7 bits (76), Expect = 0.081 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 316 GRCSCCSGWPGCACSPGLLQSLYALPSAARP 408 GRCSC +GW G +C+ Y + ARP Sbjct: 685 GRCSCGTGWTGPSCNASCSAGRYGINCVARP 715 >SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) Length = 490 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 5/91 (5%) Frame = -2 Query: 458 DQLQSDQRTEFVPCPGFGRAALGSAYNDCNSPGEHAQPGHPEQH---EQRPTQVHPERIV 288 ++ Q D+RT+ + + SA + G+ H + E+ + V+P +V Sbjct: 218 ERYQGDERTQETDTFSYEENRISSAPHSSTEQGDFPSK-HESSYPRVEKNVSYVYPSNVV 276 Query: 287 SILQYL--LSRHPVNCRLLASSSIFASPFLW 201 S++ L H V+CR+ S+ PF W Sbjct: 277 SLVGVTGTLDAHVVSCRVRVVRSLQGFPFAW 307 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 5/91 (5%) Frame = -2 Query: 458 DQLQSDQRTEFVPCPGFGRAALGSAYNDCNSPGEHAQPGHPEQH---EQRPTQVHPERIV 288 ++ Q D+RT+ + + SA + G+ H + E+ + V+P +V Sbjct: 209 ERYQGDERTQETDTFSYEENRISSAPHSSTEQGDFPSK-HESSYPRVEKNVSYVYPSNVV 267 Query: 287 SILQYL--LSRHPVNCRLLASSSIFASPFLW 201 S++ L H V+CR+ S+ PF W Sbjct: 268 SLVGVTGTLDAHVVSCRVRVVRSLQGFPFAW 298 >SB_50345| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1021 Score = 31.9 bits (69), Expect = 0.57 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = -2 Query: 470 FDGIDQLQSDQRTEFVPCPGFGRAALGSAYNDCNSPGEHA-QPGHPEQHEQRPTQVHPER 294 F D+L S + + + LG YND N+ A P H H Q PT+ + Sbjct: 933 FSSGDELDSGKGDSSIASSPYTSHTLGRRYNDHNNHSHTAFNPHHTMNHTQNPTRHNKYP 992 Query: 293 IVSI 282 +V+I Sbjct: 993 VVTI 996 >SB_52466| Best HMM Match : Cation_ATPase_C (HMM E-Value=6.7e-12) Length = 573 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -2 Query: 344 GHPEQHEQRPTQVHPERIVSILQYLLSRHPVNCRLLASSSIFASPFLW 201 G+ + RPTQ H + + + + VNCR ++S ++F+ PF W Sbjct: 311 GYSAESLCRPTQ-HSTMVFTTFILMQLFNEVNCRRVSSRNVFSGPFDW 357 >SB_23440| Best HMM Match : BAT2_N (HMM E-Value=7.5) Length = 262 Score = 31.5 bits (68), Expect = 0.75 Identities = 23/62 (37%), Positives = 32/62 (51%) Frame = -3 Query: 451 SSPTRGPSSYHVLGSGGPHLGARTMTAIAPASMHSQATQNNTNSDQRKFTQKGSSAYFST 272 +SPT GP + L + +T I P H Q+ QNNTN ++ K ++K S ST Sbjct: 202 TSPTIGPKHHQQLAQNITNNRPKTSPTIGP-KHHQQSAQNNTN-NRPKTSRKYMS--IST 257 Query: 271 SS 266 SS Sbjct: 258 SS 259 >SB_10520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 30.7 bits (66), Expect = 1.3 Identities = 28/95 (29%), Positives = 40/95 (42%) Frame = -2 Query: 449 QSDQRTEFVPCPGFGRAALGSAYNDCNSPGEHAQPGHPEQHEQRPTQVHPERIVSILQYL 270 Q RT P P +G A N S EH PGH Q E+I S + Sbjct: 160 QLRMRTCDNPAPAYGGADCPGPANKTRSCNEHPCPGHSFQ----------EQISSSSNTV 209 Query: 269 LSRHPVNCRLLASSSIFASPFLWSPTTYFASDMST 165 L++ P R++A SS SP + + +S ++T Sbjct: 210 LTQWPQTSRIIAFSSSEYSPSSYWSSRDVSSSLTT 244 >SB_42099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 325 SCCSGWPGCACSPGLLQSLYALPSAARPNP 414 S C G PG C S+YA+ S +P P Sbjct: 73 SACKGDPGIICGGPYRNSIYAVESTVKPPP 102 >SB_3454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 319 RCSCCSGWPGCACSPG---LLQSLYALPSAARPNPGH 420 RC+C SGW G +C G + Y + NPG+ Sbjct: 68 RCNCMSGWQGLSCEVGCGSCHPNAYCMMDKCVCNPGY 104 >SB_22952| Best HMM Match : EGF_2 (HMM E-Value=2e-23) Length = 300 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/19 (57%), Positives = 11/19 (57%), Gaps = 2/19 (10%) Frame = +1 Query: 316 GRCSCCSGWPG--CACSPG 366 G C C GW G C CSPG Sbjct: 245 GTCQCKPGWTGIDCECSPG 263 >SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) Length = 618 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +3 Query: 267 EEVLKYADDPFWVNLRWSLF--VLFWVAWLCMLAGAIAVIVRA 389 E +LKY D+ W V F++A LC +AG +AV+ +A Sbjct: 347 ECLLKYTDNVIGTFKYWFFIHSVFFFLAILCSIAGWVAVVSKA 389 >SB_56837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 316 GRCSCCSGWPGCACS 360 GRC C GW G ACS Sbjct: 374 GRCDCKPGWYGSACS 388 >SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -2 Query: 413 GFGRAALGSAYNDCNSPGEHAQP--GHPEQHEQRPTQVHPERIVSILQYLLSRHPVN 249 G RA Y +P + QP GHP + Q P +P+ V QY + PVN Sbjct: 664 GTTRAYPPHPYAQVPAPCGNVQPQHGHPGMYPQHPQGSYPQYHVPQQQYPGQQQPVN 720 >SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) Length = 815 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 721 PDEIISVGLSAVLTLY-EPGMVGEHVVRNQINNHSYSDLLNFVEQNFEF 578 PDE+ VGL A+ LY E + + N+ N + ++ + + Q+ F Sbjct: 398 PDEVYQVGLDALDKLYLEALKIAREITGNESNETAKAEFIKMLNQSEMF 446 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/66 (28%), Positives = 29/66 (43%) Frame = -2 Query: 473 WFDGIDQLQSDQRTEFVPCPGFGRAALGSAYNDCNSPGEHAQPGHPEQHEQRPTQVHPER 294 W +G Q+D T+F P GR +Y++ P +QP E +V P Sbjct: 1176 WIEGWRTYQTDDSTQFTESPTAGRCQ--RSYSEF-YPTTFSQPSSRESRSDMRVEV-PSA 1231 Query: 293 IVSILQ 276 +VS L+ Sbjct: 1232 LVSALK 1237 >SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 653 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/80 (21%), Positives = 35/80 (43%) Frame = -2 Query: 446 SDQRTEFVPCPGFGRAALGSAYNDCNSPGEHAQPGHPEQHEQRPTQVHPERIVSILQYLL 267 SD+ TE C A + + + S G+ PG + + + PE + ++ + + Sbjct: 353 SDEYTELATCEQHEDAPMSKSLDSDQSTGQDKTPGFSDCRKDAKLEKDPEESLLLICWKV 412 Query: 266 SRHPVNCRLLASSSIFASPF 207 C +A++S++ S F Sbjct: 413 FPRFTYC-YIAATSLWLSKF 431 >SB_30923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +1 Query: 310 CV-GRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHGTNSVLWSDWSWSMPSNHKIY 483 C+ G C C +G+ G + +PSAA P + + D + P N+ IY Sbjct: 563 CIHGHCKCRAGYIGTGYECMKAAIYHVIPSAAFARPAPPSPPQAYMDVLTASPQNYGIY 621 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,745,922 Number of Sequences: 59808 Number of extensions: 444087 Number of successful extensions: 1681 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1679 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -