BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30226 (747 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 53 1e-08 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 42 2e-05 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 31 0.050 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 26 1.4 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 26 1.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 1.9 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 1.9 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 3.3 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 24 4.3 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 24 4.3 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 24 5.7 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 5.7 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 7.6 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.6 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 7.6 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 7.6 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 52.8 bits (121), Expect = 1e-08 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +2 Query: 569 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYTDYFIW 721 TL +FK L + KK+ +R+I+D +PN+ H WF +S Y DY++W Sbjct: 95 TLADFKQLVEEAKKLQLRIILDFVPNHSSDEHEWFKKSVQRVSGYEDYYVW 145 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 42.3 bits (95), Expect = 2e-05 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 6/65 (9%) Frame = +2 Query: 545 YEVLDKRDTLDEF------KILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYT 706 Y++ D RD EF + L G+++I+D +PN+ WF++S Y+ Sbjct: 82 YDIADFRDIHSEFGTIADLEALATACNAEGLKLILDFVPNHSSDESEWFLKSVQKDPTYS 141 Query: 707 DYFIW 721 DY++W Sbjct: 142 DYYVW 146 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 30.7 bits (66), Expect = 0.050 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 310 CV-GRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHGT 426 CV G+C C GW G AC P GHGT Sbjct: 611 CVCGQCECREGWTGPACDCRASNETCMPPGGGELCSGHGT 650 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 246 AIHGMTREEVLKYADDPFWVNLRWSLFVLF-WVAWLCMLAGAIAVIVRAP 392 A H E+ K +D W + L LF W+ L +LAG +I++AP Sbjct: 481 AEHTKMLEDSTKVKED--WKYVAMVLDRLFLWIFTLAVLAGTAGIILQAP 528 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 246 AIHGMTREEVLKYADDPFWVNLRWSLFVLF-WVAWLCMLAGAIAVIVRAP 392 A H E+ K +D W + L LF W+ L +LAG +I++AP Sbjct: 481 AEHTKMLEDSTKVKED--WKYVAMVLDRLFLWIFTLAVLAGTAGIILQAP 528 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 25.4 bits (53), Expect = 1.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 352 ACSPGLLQSLYALPSAARPNPGHGTNSVLWSD 447 A S L S+Y L S A P P G + +L+SD Sbjct: 1529 AGSAWLGASVYGLLSEAAPGPDSGNHILLFSD 1560 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 25.4 bits (53), Expect = 1.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 352 ACSPGLLQSLYALPSAARPNPGHGTNSVLWSD 447 A S L S+Y L S A P P G + +L+SD Sbjct: 1526 AGSAWLGASVYGLLSEAAPEPDSGNHILLFSD 1557 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 280 SMLTILSG*TCVGRCSCCSGWPGCACSPGLLQS 378 S L +G G+C C GW G C L S Sbjct: 478 SELCNFNGDYVCGQCQCYVGWIGKTCECNLQNS 510 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 307 TCVGRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHG 423 TC G CSC W G C + PS GHG Sbjct: 579 TC-GTCSCFDSWSGDNCECTTDTTGCKAPSNDAVCSGHG 616 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 343 PGCACSPGLLQSLYALPSAARPNPGHGTNSV 435 PGC C G Y L A P HG +V Sbjct: 225 PGCVCFGGQEPEQYVLLPAGPPCAPHGLFNV 255 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 307 TCVGRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHG 423 TC G CSC W G C + PS GHG Sbjct: 3 TC-GTCSCFDSWSGDNCECTTDTTGCKAPSNDAVCSGHG 40 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 307 TCVGRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHG 423 TC G CSC W G C + PS GHG Sbjct: 3 TC-GTCSCFDSWSGDNCECTTDTTGCKAPSNDAVCSGHG 40 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 307 TCVGRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHG 423 TC G CSC W G C + PS GHG Sbjct: 3 TC-GTCSCFDSWSGDNCECTTDTTGCKAPSNDAVCSGHG 40 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 307 TCVGRCSCCSGWPGCACSPGLLQSLYALPSAARPNPGHG 423 TC G CSC W G C + PS GHG Sbjct: 3 TC-GTCSCFDSWSGDNCECTTDTTGCKAPSNDAVCSGHG 40 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.8 bits (49), Expect = 5.7 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 426 RTMSWVRAGRTW 391 RTM W+R+G W Sbjct: 270 RTMCWIRSGAIW 281 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = +1 Query: 46 LISEFRSSKTNLGKSK---EKISAD 111 ++SE + ++T GKSK EKI AD Sbjct: 714 IVSEMQKTETKQGKSKDAFEKIQAD 738 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 356 HAQPGHPEQHEQRPTQVHP 300 H Q HP H+Q+ +Q HP Sbjct: 254 HQQQQHPSSHQQQ-SQQHP 271 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 356 HAQPGHPEQHEQRPTQVHP 300 H Q HP H+Q+ +Q HP Sbjct: 254 HQQQQHPSSHQQQ-SQQHP 271 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 356 HAQPGHPEQHEQRPTQVHP 300 H Q HP H+Q+ +Q HP Sbjct: 206 HQQQQHPSSHQQQ-SQQHP 223 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 356 HAQPGHPEQHEQRPTQVHP 300 H Q HP H+Q+ +Q HP Sbjct: 254 HQQQQHPSSHQQQ-SQQHP 271 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,328 Number of Sequences: 2352 Number of extensions: 13935 Number of successful extensions: 54 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -