BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30226 (747 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 54 2e-09 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 48 7e-08 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 48 7e-08 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 46 3e-07 S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 26 0.33 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.7 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 3.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 4.0 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 5.3 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 5.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.3 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 7.0 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 9.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.3 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 53.6 bits (123), Expect = 2e-09 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +2 Query: 569 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYTDYFIWTKDNLLIG 745 TL +F L + K +G++VI+D +PN+ H WF +S +PY +Y++W ++ G Sbjct: 98 TLADFDRLVRRAKSLGLKVILDFVPNHSSHEHPWFKKSVQRIKPYDEYYVWRDARIVNG 156 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 48.4 bits (110), Expect = 7e-08 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +2 Query: 569 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYTDYFIWTKDNLLIG 745 T+ + L + + G+++I+D +PN+ H WF S + EPY +Y+IW ++ G Sbjct: 98 TISDLDNLVSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYYIWHPGKIVNG 156 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 48.4 bits (110), Expect = 7e-08 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +2 Query: 569 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYTDYFIWTKDNLLIG 745 T+ + L + + G+++I+D +PN+ H WF S + EPY +Y+IW ++ G Sbjct: 98 TISDLDNLVSAAHEKGLKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYYIWHPGKIVNG 156 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 46.4 bits (105), Expect = 3e-07 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 5/56 (8%) Frame = +2 Query: 569 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQS-----ENSTEPYTDYFIW 721 T+ + + L + KK ++VI+DL+PN+ H WF S N+T Y DY+IW Sbjct: 96 TIKDLEDLTAEAKKQNLKVILDLVPNHTSDQHKWFQMSINNTNNNNTNKYKDYYIW 151 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 26.2 bits (55), Expect = 0.33 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 336 WVAWLCMLAGAIAVIVRAPKCGPPEPRTWY-ELGPLVGLELVD 461 WV C I VI++ P CGP ++ +L PL L D Sbjct: 9 WVGGFCHSIIQIPVIIQLPFCGPNVIDHYFRDLQPLFKLACTD 51 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 1.3 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 246 AIHGMTREEVLKYADDPFWVNLRWSLFVLF-WVAWLCMLAGAIAVIVRAP 392 A H E+ K +D W + L LF W+ L +L G +I++AP Sbjct: 495 AEHTKMLEDSTKVKED--WKYVAMVLDRLFLWIFTLAVLVGTAGIILQAP 542 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 1.3 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 246 AIHGMTREEVLKYADDPFWVNLRWSLFVLF-WVAWLCMLAGAIAVIVRAP 392 A H E+ K +D W + L LF W+ L +L G +I++AP Sbjct: 495 AEHTKMLEDSTKVKED--WKYVAMVLDRLFLWIFTLAVLVGTAGIILQAP 542 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Frame = -2 Query: 374 CNSPGEHAQPG-------HPEQHEQRPTQVHPER 294 C+SPG + HP QH P+Q HP R Sbjct: 299 CHSPGVYPSTAGFLPPSYHPHQHH--PSQYHPHR 330 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 188 MSSGTTGMVTRRLNSMLINGNSRDDERGGTE 280 M++GTT + TRRL N D+R E Sbjct: 254 MTTGTTTIPTRRLRKRRQNDGEGADDRDDDE 284 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -3 Query: 640 NQINNHSYSDLLNFVEQNFEFVQCVTFVE---HFVSRHLDEHALNFE 509 N+INNH Y ++ + +F+ T E + + +++E LN + Sbjct: 446 NKINNHEYKRSVSRESNSNQFILMTTVNEGNNNMAATYMNECLLNIQ 492 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 3.0 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -2 Query: 374 CNSPGEHAQPGHPEQHEQRPTQVHPERIVSILQYLLSRHPVNCRLLASSSIFA 216 C SP + ++ E+R + P+RI + L P++C S I A Sbjct: 618 CPSPPVTTKRDGTQETEERLPPLPPKRIRKMPSMPLLPRPISCHTTPDSFIEA 670 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 4.0 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 246 AIHGMTREEVLKYADDPFWVNLRWSLFVLF-WVAWLCMLAGAIAVIVRAP 392 A H E+ + +D W + L LF W+ L ++ G +I++AP Sbjct: 490 ADHTKREEDSTRVKED--WKYVAMVLDRLFLWIFTLAVVVGTAGIILQAP 537 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.2 bits (45), Expect = 5.3 Identities = 6/21 (28%), Positives = 13/21 (61%) Frame = -2 Query: 221 FASPFLWSPTTYFASDMSTRV 159 F +W+PT Y +++ S+ + Sbjct: 92 FVRDLIWTPTVYVSNEPSSAI 112 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 242 LLASSSIFASPFLWSPTTYFASDMST 165 +L S FA +W P T+FA+D ++ Sbjct: 105 VLTLSGDFAEK-IWVPDTFFANDKNS 129 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 407 GRAALGSAYNDCNSPGEHAQPGHPEQHEQ 321 GR ++GSA N S P P H+Q Sbjct: 1841 GRRSVGSARNIPVSGSPEPPPPPPRNHDQ 1869 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 327 VLFWVAWLCMLAGAIAVIVRAP 392 + WV L AG + +I +AP Sbjct: 484 LFLWVFTLACTAGTLGIIFQAP 505 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -2 Query: 305 HPERIVSILQYLLSRHPVNCRLLASSSI 222 HP ++ + +YL + N R ++S I Sbjct: 40 HPTTLLKLKRYLFCEYDPNVRPISSHQI 67 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 534 KCRLTKCSTNVTHWTNSKFCSTKLR 608 +CR S + +KFCST+ R Sbjct: 435 QCRYPNASVTPYNKNYTKFCSTEKR 459 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,150 Number of Sequences: 438 Number of extensions: 3790 Number of successful extensions: 24 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -