BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30226 (747 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21326.1 68414.m02666 VQ motif-containing protein contains PF... 31 1.1 At5g15050.1 68418.m01764 glycosyltransferase family 14 protein /... 29 2.5 At1g21320.1 68414.m02664 VQ motif-containing protein contains PF... 29 2.5 At4g30870.1 68417.m04383 repair endonuclease family protein cont... 29 4.3 At2g41560.1 68415.m05136 calcium-transporting ATPase 4, plasma m... 29 4.3 At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g... 29 4.3 At2g39930.1 68415.m04907 isoamylase, putative / starch debranchi... 28 5.7 At5g02110.1 68418.m00132 cyclin family protein low similarity to... 28 7.6 At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS... 28 7.6 At3g51520.1 68416.m05642 diacylglycerol acyltransferase family c... 28 7.6 At2g26420.1 68415.m03170 1-phosphatidylinositol-4-phosphate 5-ki... 28 7.6 At1g74070.1 68414.m08579 peptidyl-prolyl cis-trans isomerase cyc... 28 7.6 At1g09980.1 68414.m01126 expressed protein contains Pfam profile... 28 7.6 At5g59130.1 68418.m07411 subtilase family protein contains simil... 27 10.0 At2g20590.2 68415.m02408 reticulon family protein non-consensus ... 27 10.0 At2g20590.1 68415.m02407 reticulon family protein non-consensus ... 27 10.0 >At1g21326.1 68414.m02666 VQ motif-containing protein contains PF05678: VQ motif Length = 239 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 9/75 (12%) Frame = -2 Query: 356 HAQPGHPEQHEQRPTQVHPER----IVSILQYLLSRHPVNC-----RLLASSSIFASPFL 204 H QP P+ H+Q P+Q P I ++ ++ HP N RL +S + Sbjct: 38 HPQPQPPQTHQQEPSQSRPPPGPVIIYTVSPRIIHTHPNNFMTLVQRLTGKTSTSTTSSS 97 Query: 203 WSPTTYFASDMSTRV 159 +S +T D ST V Sbjct: 98 YSSSTSAPKDASTMV 112 >At5g15050.1 68418.m01764 glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein contains Pfam profile: PF02485 Core-2/I-Branching enzyme Length = 434 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 650 VFTNHTWFVQSENSTEPYTDYFIWTKDNL 736 +FT W + S P+ DYFIW DNL Sbjct: 261 LFTGSAWMMLSR----PFVDYFIWGWDNL 285 >At1g21320.1 68414.m02664 VQ motif-containing protein contains PF05678: VQ motif Length = 235 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 9/75 (12%) Frame = -2 Query: 356 HAQPGHPEQHEQRPTQVHPE----RIVSILQYLLSRHPVNC-----RLLASSSIFASPFL 204 H QP P+ H+Q P+Q P I ++ ++ HP N RL +S + Sbjct: 38 HPQPQPPQTHQQEPSQSRPPPGPVNIYTVTPRIIHTHPNNFMTLVQRLTGQTSTSTTSSS 97 Query: 203 WSPTTYFASDMSTRV 159 S +T D ST V Sbjct: 98 SSSSTSEPKDTSTMV 112 >At4g30870.1 68417.m04383 repair endonuclease family protein contains Pfam PF02732 : ERCC4 domain; similar to repair endonuclease (TIGR:At5g41150) [Arabidopsis thaliana] Length = 661 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 504 KTSKFRACSSKCRLTKCSTNVTHWTNSKFCSTKLRR 611 + KFR+C+ L CS+ +H K CS+ +RR Sbjct: 302 RAKKFRSCNDGSTLNPCSSGSSHAV--KACSSSVRR 335 >At2g41560.1 68415.m05136 calcium-transporting ATPase 4, plasma membrane-type / Ca2+-ATPase, isoform 4 (ACA4) identical to SP|O22218 Calcium-transporting ATPase 4, plasma membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 4) {Arabidopsis thaliana} Length = 1030 Score = 28.7 bits (61), Expect = 4.3 Identities = 8/31 (25%), Positives = 22/31 (70%) Frame = +1 Query: 421 GTNSVLWSDWSWSMPSNHKIYNRIWNC*RLQ 513 G+++ + +D + ++ +NH + N++W C ++Q Sbjct: 443 GSSTCICTDKTGTLTTNHMVVNKVWICDKVQ 473 >At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-glucan glucanohydrolase, putative similar to SP|P17859 Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo}, alpha-amylase [Malus x domestica] GI:7532799; contains Pfam profile PF00128: Alpha amylase, catalytic domain Length = 887 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 545 YEVLDKRDTLDEFKILFNKIKKIGVRVIVDLIPNY 649 Y + + T+DE K K K+G++V+ D + N+ Sbjct: 551 YNLNSRYGTIDELKDTVKKFHKVGIKVLGDAVLNH 585 >At2g39930.1 68415.m04907 isoamylase, putative / starch debranching enzyme, putative similar to isoamylase from [Solanum tuberosum] GI:27728145, [Triticum aestivum] GI:17932898, [Hordeum vulgare] GI:21314275, [Oryza sativa] GI:3252794; contains Pfam profiles PF00128: Alpha amylase catalytic domain, PF02922: Isoamylase N-terminal domain Length = 783 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 572 LDEFKILFNKIKKIGVRVIVDLIPNY 649 ++EFKIL + K G+ VI+D++ N+ Sbjct: 315 INEFKILVKEAHKRGIEVIMDVVLNH 340 >At5g02110.1 68418.m00132 cyclin family protein low similarity to cyclin D3.1 from [Lycopersicon esculentum] GI:5679622, [Nicotiana tabacum] GI:4160300; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain Length = 341 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 667 GMVGEHVVRNQINNH 623 GMVG+H++ N+I NH Sbjct: 194 GMVGDHMIMNRITNH 208 >At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. identical to RPS2 (gi:13661831) Length = 909 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 6/46 (13%) Frame = -3 Query: 688 VLTLYEPGMVGEHVVRNQINN------HSYSDLLNFVEQNFEFVQC 569 ++ +Y PG VG+ + INN H Y D+L +V+ + EF +C Sbjct: 177 IIGVYGPGGVGKTTLMQSINNELITKGHQY-DVLIWVQMSREFGEC 221 >At3g51520.1 68416.m05642 diacylglycerol acyltransferase family contains Pfam PF03982: Diacylglycerol acyltransferase Length = 314 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -2 Query: 359 EHAQPGHPEQHEQRPTQVHPERIVSILQYLLSRHPV-NCRLLASSSIFASPFLWSPTTYF 183 E QP P V P +V++ L P+ N ++LASS+IF +PFL T+ Sbjct: 95 EAFQPNRAYVFGYEPHSVLPIGVVALCD-LTGFMPIPNIKVLASSAIFYTPFLRHIWTWL 153 Query: 182 ASDMSTR 162 ++R Sbjct: 154 GLTAASR 160 >At2g26420.1 68415.m03170 1-phosphatidylinositol-4-phosphate 5-kinase, putative / PIP kinase, putative / PtdIns(4)P-5-kinase, putative / diphosphoinositide kinase, putative similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 705 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 297 KDRQHTSVPPLSSSRELPFISIEFNLRVTIPVV 199 KD+Q T PP S P +S EF + P+V Sbjct: 361 KDKQWTRFPPEGSKSTPPHLSAEFKWKDYCPIV 393 >At1g74070.1 68414.m08579 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein contains Pfam domain, PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 317 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 360 AGAIAVIVRAPKCGPPEPRTWYELGPLVGLELVDAVEP 473 AG++ ++VR P PP+ + G LV E V AV P Sbjct: 192 AGSVGIVVRDPSKPPPKTKLVARNGKLVVEEEVIAVGP 229 >At1g09980.1 68414.m01126 expressed protein contains Pfam profile PF05057: Protein of unknown function (DUF676); non-consensus GC donor splice site at exon boundary 144764 Length = 802 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 164 VWTCPMRNMSSGTTGMVTRRLNSMLINGNSRDDERG 271 VW P R S + R++S L+NG+ DDE G Sbjct: 473 VWNAPRRTFSDNSYMRHVDRIDSSLLNGH--DDESG 506 >At5g59130.1 68418.m07411 subtilase family protein contains similarity to prepro-cucumisin GI:807698 from [Cucumis melo] Length = 732 Score = 27.5 bits (58), Expect = 10.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 331 CSGWPGCACSPGLLQSLYALPSAARPNPGHGTNS 432 C+G C+ L+ + + P AR + GHGT++ Sbjct: 167 CAGGKNFTCNNKLIGARHYSPGDARDSTGHGTHT 200 >At2g20590.2 68415.m02408 reticulon family protein non-consensus AA donor splice site at 46485 and non-consensus GG acceptor splice site at 46563, confirmed by Ceres cDNA 1885; contains Pfam profile PF02453: Reticulon Length = 323 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 303 PRKDRQHTSVPPLSSSRELP 244 P+KD+Q +S PPL SS +LP Sbjct: 136 PKKDKQ-SSAPPLCSSSDLP 154 >At2g20590.1 68415.m02407 reticulon family protein non-consensus AA donor splice site at 46485 and non-consensus GG acceptor splice site at 46563, confirmed by Ceres cDNA 1885; contains Pfam profile PF02453: Reticulon Length = 431 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 303 PRKDRQHTSVPPLSSSRELP 244 P+KD+Q +S PPL SS +LP Sbjct: 136 PKKDKQ-SSAPPLCSSSDLP 154 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,801,192 Number of Sequences: 28952 Number of extensions: 295132 Number of successful extensions: 1016 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -