BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30224X (533 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0854 - 21905054-21906308,21906396-21907300 31 0.77 09_03_0179 - 13131404-13131514,13131834-13131920,13132316-131324... 29 1.8 01_01_1205 - 9693702-9694517,9694591-9695076,9697014-9697095,969... 27 9.5 >08_02_0854 - 21905054-21906308,21906396-21907300 Length = 719 Score = 30.7 bits (66), Expect = 0.77 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -3 Query: 129 EISAPTTSNQTRLITTKKHYFHIVKPVVAAIQFAIL 22 E++ TS R T KHY+H+V+ +AAI AIL Sbjct: 583 EVNERETSTHRRHKVTNKHYYHVVEIYLAAID-AIL 617 >09_03_0179 - 13131404-13131514,13131834-13131920,13132316-13132448, 13133079-13133319,13133423-13133540,13133546-13133731, 13133864-13134049,13134443-13134652,13135171-13135347, 13135823-13135964,13136385-13136927,13137565-13138022 Length = 863 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = -2 Query: 175 QRTQRCLIS*TRLVRGNISPYYEQPDATNYD*KTLFSHS 59 Q QRC R VRG + +YEQP AT D T+ S Sbjct: 783 QEAQRCFED-CRRVRGLVDEWYEQPAATVVDWVTIDGQS 820 >01_01_1205 - 9693702-9694517,9694591-9695076,9697014-9697095, 9697876-9698051,9698326-9698580 Length = 604 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 304 YDPSLVILILKYKRLRARPILDWIDSDLFPSRYRLA*NG 420 Y PS+ IL + L+ DW SD P+R+ L G Sbjct: 507 YRPSMPILSVVVPELKQTDSFDWTCSDEAPARHSLIVRG 545 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,785,730 Number of Sequences: 37544 Number of extensions: 176205 Number of successful extensions: 315 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -