BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30224X (533 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58527| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.45 SB_49645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 >SB_58527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1659 Score = 31.5 bits (68), Expect = 0.45 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 5/70 (7%) Frame = -2 Query: 217 RMYQQNVNKVHEK*QRTQRCLI--S*TRLVRG---NISPYYEQPDATNYD*KTLFSHSQT 53 +++ + + H+ T+ CL + R+++ N+ PY+ PD T+ FS + Sbjct: 1264 KVFVERIGCAHDSLASTRECLYRSNVARIIQKSPWNVYPYWSMPDLTDLPTPGFFSGALA 1323 Query: 52 RSSGHSICYP 23 GH + YP Sbjct: 1324 TVDGHVVPYP 1333 >SB_49645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 2/75 (2%) Frame = -2 Query: 313 WDHNRCDRDVASQNGANSRYILYLFSTKPYI*RMYQQNVN-KVHEK*QRTQ-RCLIS*TR 140 W+ + + +++ A S +YLF + ++ R+Y +N K+ E R + + L+S ++ Sbjct: 69 WELRQREEEISELQKALSDMQVYLFQEREHVLRLYAENDRLKIRELEDRKKIQHLLSLSK 128 Query: 139 LVRGNISPYYEQPDA 95 I+ +++QP A Sbjct: 129 ATEPEITYFHKQPPA 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,119,242 Number of Sequences: 59808 Number of extensions: 227192 Number of successful extensions: 268 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -